Rv0416

Tuberculist information
Gene namethiS
Protein functionPossible protein ThiS
Functional category(tuberculist)intermediary metabolism and respiration
Gene location(kb)502.167
Molecular mass(da)7367.51
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 68
	  		  	1    MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSDWATKICELRKPVRLE   60
			  	61   VVTAVQGG

Known structures in the PDB
No Known structures
1 7 13 19 25 31 37 43 49 55 61 Range: 2 to 68  |  Coverage: 97% ThiS Range: 2 to 68  |  Coverage: 97% 1 Range: 1 to 68  |  Coverage: 98% 1
Number of amino acids : 68
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
ThiSPF025972-68
Mtb Structural Proteome models
Model Number1
Model nameRv0416
Template1ZUD    2PDBCREDO
Template coverage2_66
Template Identity(%)24.6
Model coverage(%)97.1
Normalized DOPE score-0.22

Structure Models from Chopin
Model Number1
Profiled.15.3.2 - 3.10.20.30
Click for model details
zscore14.2
Residue begin1
Residue end68
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv0416Gene nameConfidence Score
Rv0415thiO0.989
Rv0417thiG0.986
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions