SInCRe - Rv0410c

Tuberculist information

Gene name	pknG
Protein function	Serine/threonine-protein kinase PknG (protein kinase G) (STPK G)
Functional category(tuberculist)	regulatory proteins
Gene location(kb)	495.062
Molecular mass(da)	81577.4
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 750

	  		  	1    MAKASETERSGPGTQPADAQTATSATVRPLSTQAVFRPDFGDEDNFPHPTLGPDTEPQDR   60
			  	61   MATTSRVRPPVRRLGGGLVEIPRAPDIDPLEALMTNPVVPESKRFCWNCGRPVGRSDSET  120
			  	121  KGASEGWCPYCGSPYSFLPQLNPGDIVAGQYEVKGCIAHGGLGWIYLALDRNVNGRPVVL  180
			  	181  KGLVHSGDAEAQAMAMAERQFLAEVVHPSIVQIFNFVEHTDRHGDPVGYIVMEYVGGQSL  240
			  	241  KRSKGQKLPVAEAIAYLLEILPALSYLHSIGLVYNDLKPENIMLTEEQLKLIDLGAVSRI  300
			  	301  NSFGYLYGTPGFQAPEIVRTGPTVATDIYTVGRTLAALTLDLPTRNGRYVDGLPEDDPVL  360
			  	361  KTYDSYGRLLRRAIDPDPRQRFTTAEEMSAQLTGVLREVVAQDTGVPRPGLSTIFSPSRS  420
			  	421  TFGVDLLVAHTDVYLDGQVHAEKLTANEIVTALSVPLVDPTDVAASVLQATVLSQPVQTL  480
			  	481  DSLRAARHGALDADGVDFSESVELPLMEVRALLDLGDVAKATRKLDDLAERVGWRWRLVW  540
			  	541  YRAVAELLTGDYDSATKHFTEVLDTFPGELAPKLALAATAELAGNTDEHKFYQTVWSTND  600
			  	601  GVISAAFGLARARSAEGDRVGAVRTLDEVPPTSRHFTTARLTSAVTLLSGRSTSEVTEEQ  660
			  	661  IRDAARRVEALPPTEPRVLQIRALVLGGALDWLKDNKASTNHILGFPFTSHGLRLGVEAS  720
			  	721  LRSLARVAPTQRHRYTLVDMANKVRPTSTF

Known structures in the PDB

	PDB ID	2PZI
	Total residue count	1362
	Number of chains	2
	Method	X-RAY
	Resolution	2.4

Number of amino acids : 750

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Pkinase	PF00069	151-403

Mtb Structural Proteome models

Model Number	1
Model name	Rv0410c_2pzi_A
Template	2PZI APDB CREDO
Template coverage	69_746
Template Identity(%)	100.0
Model coverage(%)	90.3
Normalized DOPE score	-1.361

Model Number	2
Model name	Rv0410c.6
Template	2AVP APDB CREDO
Template coverage	1_68
Template Identity(%)	16.2
Model coverage(%)	9.5
Normalized DOPE score	-0.757

Model Number	3
Model name	Rv0410c.5
Template	2FO7 APDB CREDO
Template coverage	9_134
Template Identity(%)	20.0
Model coverage(%)	16.5
Normalized DOPE score	-0.479

Model Number	4
Model name	Rv0410c.2
Template	1K9A APDB CREDO
Template coverage	52_442
Template Identity(%)	16.1
Model coverage(%)	51.1
Normalized DOPE score	0.067

Model Number	5
Model name	Rv0410c
Template	2ACX APDB CREDO
Template coverage	93_451
Template Identity(%)	23.2
Model coverage(%)	45.3
Normalized DOPE score	0.08

Model Number	6
Model name	Rv0410c.1
Template	1OPK APDB CREDO
Template coverage	122_511
Template Identity(%)	15.9
Model coverage(%)	51.1
Normalized DOPE score	0.389

Structure Models from Chopin

Model Number	1
Profile	1.10.510.10 Click for model details
zscore	13.93
Residue begin	183
Residue end	536

Model Number	2
Profile	d.144.1.9 Click for model details
zscore	10.49
Residue begin	150
Residue end	337

Model Number	3
Profile	d.144.1.7 Click for model details
zscore	9.31
Residue begin	1
Residue end	703

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0410c	Gene name	Confidence Score
Rv0412c	Rv0412c	0.99
Rv0411c	glnH	0.976
Rv0018c	pstP	0.94
Rv1747	Rv1747	0.91
Rv1747	Rv1747	0.91
Rv1747	Rv1747	0.91

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0410c.2	5	1uwj_BAX_A_1723 PDB CREDO	0.614	0.163	0.614	0.002
Rv0410c.2	12	1uwj_BAX_B_1723 PDB CREDO	0.630	0.144	0.612	0.002
Rv0410c.2	12	1uwh_BAX_B_1723 PDB CREDO	0.629	0.146	0.610	0.002
Rv0410c.2	12	1uwh_BAX_A_1723 PDB CREDO	0.628	0.147	0.610	0.002
Rv0410c.2	12	1uob_PNN_A_1311 PDB CREDO	0.609	0.168	0.609	0.002
Rv0410c.1	10	2hyy_STI_D_600 PDB CREDO	0.626	0.149	0.608	0.002
Rv0410c_2pzi_A	9	1hwi_115_A_2 PDB CREDO	0.607	0.171	0.607	0.002
Rv0410c.2	12	1uwj_BAX_A_1723 PDB CREDO	0.681	0.096	0.606	0.002
Rv0410c_2pzi_A	9	3ut5_LOC_D_502 PDB CREDO	0.667	0.109	0.605	0.002
Rv0410c.1	10	2hyy_STI_A_600 PDB CREDO	0.623	0.153	0.605	0.002
Rv0410c.1	10	3pyy_STI_A_3 PDB CREDO	0.621	0.154	0.604	0.002
Rv0410c.1	10	1iep_STI_B_202 PDB CREDO	0.621	0.155	0.603	0.002
Rv0410c.1	10	1iep_STI_A_201 PDB CREDO	0.621	0.155	0.603	0.002
Rv0410c.1	10	3k5v_STI_B_2 PDB CREDO	0.620	0.156	0.602	0.002
Rv0410c.1	10	3mss_STI_C_1 PDB CREDO	0.619	0.157	0.602	0.002
Rv0410c.1	10	3pyy_STI_B_4 PDB CREDO	0.619	0.158	0.601	0.002
Rv0410c.1	10	2hyy_STI_C_600 PDB CREDO	0.618	0.158	0.600	0.002
Rv0410c.1	10	3ms9_STI_A_1 PDB CREDO	0.617	0.159	0.600	0.002
Rv0410c.1	10	3ms9_STI_B_1 PDB CREDO	0.617	0.159	0.599	0.002
Rv0410c.1	10	3mss_STI_A_1 PDB CREDO	0.617	0.159	0.599	0.002
Rv0410c.1	10	3mss_STI_D_1 PDB CREDO	0.615	0.161	0.598	0.002
Rv0410c.1	10	3mss_STI_B_1 PDB CREDO	0.613	0.164	0.595	0.002
Rv0410c.1	10	3gvu_STI_A_1001 PDB CREDO	0.613	0.164	0.595	0.002
Rv0410c_2pzi_A	9	3ut5_LOC_B_502 PDB CREDO	0.697	0.083	0.594	0.002
Rv0410c.2	12	4asd_BAX_A_1500 PDB CREDO	0.611	0.167	0.593	0.002
Rv0410c_2pzi_A	9	1lhv_NOG_A_301 PDB CREDO	0.632	0.143	0.592	0.002
Rv0410c.2	5	3d91_REM_A_350 PDB CREDO	0.646	0.128	0.592	0.002
Rv0410c.2	5	3d91_REM_B_350 PDB CREDO	0.636	0.139	0.583	0.003
Rv0410c_2pzi_A	9	1jg2_ADN_A_500 PDB CREDO	0.644	0.130	0.582	0.003
Rv0410c.2	5	1uwj_BAX_B_1723 PDB CREDO	0.632	0.143	0.579	0.003
Rv0410c.2	5	1uwh_BAX_B_1723 PDB CREDO	0.670	0.105	0.579	0.003
Rv0410c.2	5	1uwh_BAX_A_1723 PDB CREDO	0.669	0.106	0.578	0.003
Rv0410c.2	5	3pww_ROC_A_1001 PDB CREDO	0.661	0.114	0.576	0.003
Rv0410c.2	12	1y0x_T44_X_500 PDB CREDO	0.593	0.188	0.575	0.003
Rv0410c.1	10	3k5v_STI_A_2 PDB CREDO	0.626	0.149	0.575	0.003
Rv0410c_2pzi_A	9	3tkd_CYZ_A_266 PDB CREDO	0.629	0.146	0.571	0.004
Rv0410c.1	10	1uwj_BAX_B_1723 PDB CREDO	0.587	0.195	0.570	0.004
Rv0410c_2pzi_A	9	2xpv_MIY_A_1209 PDB CREDO	0.652	0.122	0.569	0.004
Rv0410c.1	10	2hyy_STI_B_600 PDB CREDO	0.603	0.175	0.569	0.004
Rv0410c.2	12	2hyy_STI_B_600 PDB CREDO	0.568	0.219	0.568	0.004
Rv0410c.2	12	3tne_RIT_A_401 PDB CREDO	0.623	0.153	0.568	0.004
Rv0410c.1	10	3oez_STI_A_601 PDB CREDO	0.584	0.198	0.568	0.004
Rv0410c.2	12	3uvv_T3_A_501 PDB CREDO	0.643	0.132	0.568	0.004
Rv0410c.1	10	1opj_STI_A_3 PDB CREDO	0.635	0.140	0.567	0.004
Rv0410c.2	5	3mss_STI_B_1 PDB CREDO	0.583	0.200	0.566	0.004
Rv0410c.2	5	3gvu_STI_A_1001 PDB CREDO	0.581	0.202	0.565	0.004
Rv0410c.2	5	3mss_STI_A_1 PDB CREDO	0.581	0.203	0.565	0.004
Rv0410c.2	12	2y6o_1N1_A_1892 PDB CREDO	0.639	0.135	0.564	0.004
Rv0410c.1	10	1opj_STI_B_4 PDB CREDO	0.632	0.143	0.564	0.004
Rv0410c.2	5	3k5v_STI_B_2 PDB CREDO	0.581	0.203	0.564	0.004
Rv0410c.2	5	3pyy_STI_A_3 PDB CREDO	0.581	0.203	0.564	0.004
Rv0410c.2	5	1iep_STI_B_202 PDB CREDO	0.580	0.204	0.564	0.004
Rv0410c.2	5	3ms9_STI_B_1 PDB CREDO	0.580	0.204	0.564	0.004
Rv0410c.2	5	3mss_STI_C_1 PDB CREDO	0.580	0.204	0.564	0.004
Rv0410c.2	5	3mss_STI_D_1 PDB CREDO	0.580	0.204	0.564	0.004
Rv0410c_2pzi_A	2	1kij_NOV_A_400 PDB CREDO	0.563	0.226	0.563	0.004
Rv0410c.2	5	3ms9_STI_A_1 PDB CREDO	0.580	0.204	0.563	0.004
Rv0410c.2	12	1z2b_VLB_C_800 PDB CREDO	0.563	0.227	0.563	0.004
Rv0410c.2	12	1bsx_T3_A_1 PDB CREDO	0.657	0.118	0.562	0.004
Rv0410c.2	12	1bsx_T3_B_2 PDB CREDO	0.657	0.118	0.562	0.004
Rv0410c.2	5	1iep_STI_A_201 PDB CREDO	0.577	0.207	0.561	0.004
Rv0410c.2	5	2hyy_STI_C_600 PDB CREDO	0.577	0.207	0.561	0.004
Rv0410c.2	12	1xzx_T3_X_500 PDB CREDO	0.634	0.140	0.560	0.004
Rv0410c.2	5	3k5v_STI_A_2 PDB CREDO	0.576	0.209	0.560	0.004
Rv0410c.1	10	3nxu_RIT_A_600 PDB CREDO	0.645	0.130	0.560	0.004
Rv0410c.2	5	2hyy_STI_D_600 PDB CREDO	0.576	0.209	0.560	0.004
Rv0410c.2	5	2hyy_STI_A_600 PDB CREDO	0.576	0.209	0.559	0.004
Rv0410c.2	12	3gws_T3_X_500 PDB CREDO	0.654	0.121	0.559	0.004
Rv0410c.2	12	3heg_BAX_A_1 PDB CREDO	0.558	0.233	0.558	0.004
Rv0410c.2	5	3pyy_STI_B_4 PDB CREDO	0.573	0.212	0.557	0.004
Rv0410c.1	10	3cs9_NIL_A_600 PDB CREDO	0.624	0.152	0.557	0.004
Rv0410c.1	10	2pl0_STI_A_200 PDB CREDO	0.591	0.190	0.557	0.004
Rv0410c.2	40	2wek_DIF_B_1376 PDB CREDO	0.605	0.173	0.557	0.004
Rv0410c.1	10	3nxu_RIT_B_600 PDB CREDO	0.641	0.134	0.556	0.004
Rv0410c.2	12	2oiq_STI_A_1001 PDB CREDO	0.556	0.235	0.556	0.005
Rv0410c.1	10	1uwj_BAX_A_1723 PDB CREDO	0.589	0.193	0.556	0.005
Rv0410c_2pzi_A	9	1hwi_115_D_3 PDB CREDO	0.612	0.165	0.556	0.005
Rv0410c.1	10	4asd_BAX_A_1500 PDB CREDO	0.572	0.214	0.555	0.005
Rv0410c.1	10	2oiq_STI_A_1001 PDB CREDO	0.588	0.193	0.555	0.005
Rv0410c.2	12	3tkd_CYZ_B_267 PDB CREDO	0.571	0.216	0.554	0.005
Rv0410c_2pzi_A	9	3tne_RIT_A_401 PDB CREDO	0.609	0.168	0.553	0.005
Rv0410c.2	5	1z2b_VLB_C_800 PDB CREDO	0.621	0.154	0.553	0.005
Rv0410c_2pzi_A	9	1jg3_ADN_A_500 PDB CREDO	0.681	0.096	0.552	0.005
Rv0410c_2pzi_A	9	3tkd_CYZ_B_267 PDB CREDO	0.648	0.127	0.552	0.005
Rv0410c_2pzi_A	9	1hwl_FBI_D_3 PDB CREDO	0.667	0.108	0.552	0.005
Rv0410c_2pzi_A	9	1hwi_115_B_1 PDB CREDO	0.608	0.169	0.552	0.005
Rv0410c.2	5	3nxu_RIT_A_600 PDB CREDO	0.599	0.180	0.551	0.005
Rv0410c_2pzi_A	9	1sa1_POD_D_701 PDB CREDO	0.666	0.110	0.551	0.005
Rv0410c.1	10	3cs9_NIL_B_600 PDB CREDO	0.633	0.142	0.550	0.005
Rv0410c_2pzi_A	9	2nni_MTK_A_501 PDB CREDO	0.704	0.078	0.549	0.005
Rv0410c.2	5	1opj_STI_B_4 PDB CREDO	0.580	0.203	0.549	0.005
Rv0410c.2	12	1hwl_FBI_D_3 PDB CREDO	0.549	0.246	0.549	0.005
Rv0410c.2	5	3oez_STI_A_601 PDB CREDO	0.564	0.224	0.548	0.005
Rv0410c.2	5	3q70_RIT_A_2001 PDB CREDO	0.616	0.160	0.548	0.005
Rv0410c.2	12	1hwl_FBI_B_1 PDB CREDO	0.548	0.247	0.548	0.005
Rv0410c_2pzi_A	9	1hwl_FBI_B_1 PDB CREDO	0.662	0.113	0.548	0.005
Rv0410c.2	5	3nxu_RIT_B_600 PDB CREDO	0.596	0.184	0.548	0.005
Rv0410c.2	12	3tne_RIT_B_401 PDB CREDO	0.601	0.178	0.548	0.005
Rv0410c_2pzi_A	9	1hwk_117_D_3 PDB CREDO	0.642	0.133	0.547	0.005
Rv0410c.2	5	2x9g_LYA_A_1270 PDB CREDO	0.696	0.084	0.547	0.005
Rv0410c.2	5	1opj_STI_A_3 PDB CREDO	0.579	0.205	0.547	0.005
Rv0410c_2pzi_A	9	1hwi_115_C_4 PDB CREDO	0.604	0.174	0.546	0.005
Rv0410c.2	5	4asd_BAX_A_1500 PDB CREDO	0.595	0.185	0.546	0.005
Rv0410c.1	10	1uwh_BAX_A_1723 PDB CREDO	0.596	0.183	0.545	0.005
Rv0410c.1	10	1uwh_BAX_B_1723 PDB CREDO	0.596	0.184	0.545	0.005
Rv0410c.2	5	1t46_STI_A_3 PDB CREDO	0.625	0.151	0.545	0.005
Rv0410c.1	10	3cs9_NIL_D_600 PDB CREDO	0.661	0.114	0.544	0.006
Rv0410c.2	12	1hwk_117_B_1 PDB CREDO	0.593	0.188	0.543	0.006
Rv0410c.1	10	3cs9_NIL_C_600 PDB CREDO	0.659	0.115	0.543	0.006
Rv0410c_2pzi_A	9	1sa1_POD_B_700 PDB CREDO	0.675	0.101	0.543	0.006
Rv0410c_2pzi_A	9	3ri5_IVM_C_350 PDB CREDO	0.644	0.130	0.542	0.006
Rv0410c_2pzi_A	9	1hwl_FBI_C_4 PDB CREDO	0.655	0.120	0.542	0.006
Rv0410c_2pzi_A	9	3rif_IVM_B_403 PDB CREDO	0.644	0.131	0.542	0.006
Rv0410c.2	12	1t46_STI_A_3 PDB CREDO	0.697	0.083	0.541	0.006
Rv0410c.2	12	2pl0_STI_A_200 PDB CREDO	0.540	0.257	0.540	0.006
Rv0410c.2	12	3oez_STI_B_601 PDB CREDO	0.593	0.188	0.540	0.006
Rv0410c_2pzi_A	9	1hwl_FBI_A_2 PDB CREDO	0.653	0.121	0.540	0.006
Rv0410c_2pzi_A	9	3rif_IVM_A_402 PDB CREDO	0.642	0.132	0.540	0.006
Rv0410c_2pzi_A	9	3rif_IVM_D_402 PDB CREDO	0.642	0.132	0.540	0.006
Rv0410c.2	12	1hwl_FBI_C_4 PDB CREDO	0.540	0.258	0.540	0.006
Rv0410c.2	12	3gcs_BAX_A_401 PDB CREDO	0.556	0.236	0.540	0.006
Rv0410c.2	12	1hwl_FBI_A_2 PDB CREDO	0.539	0.259	0.539	0.006
Rv0410c.2	12	2h79_T3_A_1 PDB CREDO	0.651	0.123	0.539	0.006
Rv0410c.2	12	2hw2_RFP_A_1200 PDB CREDO	0.591	0.190	0.539	0.006
Rv0410c.2	12	3frq_ERY_B_195 PDB CREDO	0.591	0.190	0.539	0.006
Rv0410c.2	12	3k5v_STI_B_2 PDB CREDO	0.588	0.194	0.538	0.006
Rv0410c.2	12	2hyy_STI_A_600 PDB CREDO	0.588	0.194	0.538	0.006
Rv0410c.2	12	3ms9_STI_B_1 PDB CREDO	0.588	0.194	0.538	0.006
Rv0410c_2pzi_A	9	2aa5_STR_A_301 PDB CREDO	0.538	0.261	0.538	0.006
Rv0410c_2pzi_A	9	3n58_ADN_A_500 PDB CREDO	0.617	0.160	0.538	0.006
Rv0410c_2pzi_A	9	3e22_LOC_D_700 PDB CREDO	0.592	0.188	0.538	0.006
Rv0410c_2pzi_A	9	3ria_IVM_C_349 PDB CREDO	0.638	0.136	0.537	0.006
Rv0410c_2pzi_A	9	3spk_TPV_A_100 PDB CREDO	0.555	0.237	0.537	0.006
Rv0410c.2	12	3ms9_STI_A_1 PDB CREDO	0.586	0.197	0.536	0.006
Rv0410c.2	12	3pyy_STI_A_3 PDB CREDO	0.586	0.197	0.536	0.006
Rv0410c.2	12	3pyy_STI_B_4 PDB CREDO	0.586	0.197	0.536	0.006
Rv0410c_2pzi_A	9	3e22_LOC_B_700 PDB CREDO	0.591	0.190	0.536	0.006
Rv0410c.2	12	1hwk_117_A_2 PDB CREDO	0.552	0.241	0.536	0.006
Rv0410c.2	12	1lhv_NOG_A_301 PDB CREDO	0.607	0.171	0.536	0.006
Rv0410c.2	5	2hyy_STI_B_600 PDB CREDO	0.602	0.177	0.536	0.006
Rv0410c_2pzi_A	9	3rif_IVM_A_403 PDB CREDO	0.636	0.138	0.536	0.006
Rv0410c.2	12	1hwk_117_C_4 PDB CREDO	0.551	0.242	0.535	0.006
Rv0410c.2	12	3mss_STI_B_1 PDB CREDO	0.584	0.198	0.535	0.006
Rv0410c.2	12	1iep_STI_A_201 PDB CREDO	0.584	0.199	0.535	0.006
Rv0410c_2pzi_A	9	2aa5_STR_B_302 PDB CREDO	0.534	0.266	0.534	0.006
Rv0410c.2	12	2hyy_STI_C_600 PDB CREDO	0.583	0.199	0.534	0.006
Rv0410c.2	12	3mss_STI_A_1 PDB CREDO	0.583	0.199	0.534	0.006
Rv0410c.2	12	3gvu_STI_A_1001 PDB CREDO	0.583	0.200	0.534	0.006
Rv0410c_2pzi_A	2	2ya7_ZMR_B_1776 PDB CREDO	0.534	0.267	0.534	0.007
Rv0410c.2	5	3cs9_NIL_A_600 PDB CREDO	0.564	0.225	0.533	0.007
Rv0410c_2pzi_A	9	1lhu_EST_A_301 PDB CREDO	0.612	0.165	0.533	0.007
Rv0410c.2	12	3tkd_CYZ_A_266 PDB CREDO	0.585	0.198	0.533	0.007
Rv0410c.2	5	3tne_RIT_A_401 PDB CREDO	0.657	0.117	0.533	0.007
Rv0410c.2	12	3mss_STI_C_1 PDB CREDO	0.582	0.201	0.533	0.007
Rv0410c.2	12	1hwi_115_B_1 PDB CREDO	0.584	0.199	0.532	0.007
Rv0410c.2	12	3mss_STI_D_1 PDB CREDO	0.581	0.202	0.532	0.007
Rv0410c.2	12	3oez_STI_A_601 PDB CREDO	0.581	0.202	0.532	0.007
Rv0410c.2	12	3b0w_DGX_A_1 PDB CREDO	0.548	0.247	0.532	0.007
Rv0410c.2	12	1sa1_POD_B_700 PDB CREDO	0.548	0.247	0.532	0.007
Rv0410c.1	10	3rgf_BAX_A_465 PDB CREDO	0.563	0.226	0.532	0.007
Rv0410c_2pzi_A	2	2ya7_ZMR_A_1776 PDB CREDO	0.531	0.271	0.531	0.007
Rv0410c_2pzi_A	9	1hwk_117_B_1 PDB CREDO	0.701	0.080	0.531	0.007
Rv0410c.2	12	1hwi_115_D_3 PDB CREDO	0.582	0.201	0.531	0.007
Rv0410c.2	5	2pl0_STI_A_200 PDB CREDO	0.597	0.183	0.531	0.007
Rv0410c_2pzi_A	9	4e3a_ADN_B_500 PDB CREDO	0.679	0.098	0.531	0.007
Rv0410c.2	5	2qxs_RAL_B_600 PDB CREDO	0.577	0.208	0.531	0.007
Rv0410c.2	12	1hwk_117_D_3 PDB CREDO	0.547	0.248	0.531	0.007
Rv0410c.2	12	1iep_STI_B_202 PDB CREDO	0.579	0.205	0.530	0.007
Rv0410c.2	12	2hyy_STI_D_600 PDB CREDO	0.579	0.205	0.530	0.007
Rv0410c.2	5	2qxs_RAL_A_600 PDB CREDO	0.576	0.209	0.530	0.007
Rv0410c_2pzi_A	9	3bbt_FMM_D_91 PDB CREDO	0.566	0.222	0.530	0.007
Rv0410c.2	12	2h77_T3_A_1 PDB CREDO	0.661	0.114	0.529	0.007
Rv0410c_2pzi_A	9	1hwk_117_C_4 PDB CREDO	0.658	0.116	0.529	0.007
Rv0410c.1	10	3oez_STI_B_601 PDB CREDO	0.615	0.162	0.528	0.007
Rv0410c.2	5	2vn1_FK5_A_501 PDB CREDO	0.558	0.233	0.528	0.007
Rv0410c_2pzi_A	2	1a4l_DCF_B_853 PDB CREDO	0.586	0.196	0.528	0.007
Rv0410c.2	5	3b0w_DGX_B_1 PDB CREDO	0.542	0.255	0.527	0.007
Rv0410c.2	12	3b0w_DGX_B_1 PDB CREDO	0.610	0.168	0.527	0.007
Rv0410c_2pzi_A	9	1hwk_117_A_2 PDB CREDO	0.656	0.118	0.527	0.007
Rv0410c_2pzi_A	9	3tne_RIT_B_401 PDB CREDO	0.580	0.203	0.527	0.007
Rv0410c.2	12	1sa1_POD_D_701 PDB CREDO	0.526	0.278	0.526	0.007
Rv0410c_2pzi_A	2	1a4l_DCF_C_1353 PDB CREDO	0.584	0.199	0.525	0.007
Rv0410c_2pzi_A	9	3ri5_IVM_B_349 PDB CREDO	0.697	0.083	0.525	0.007
Rv0410c.2	12	2fum_MIX_D_3539 PDB CREDO	0.678	0.099	0.525	0.007
Rv0410c.2	5	3rgf_BAX_A_465 PDB CREDO	0.524	0.281	0.524	0.008
Rv0410c_2pzi_A	2	1a4l_DCF_D_1853 PDB CREDO	0.582	0.201	0.524	0.008
Rv0410c_2pzi_A	9	1jg3_ADN_B_550 PDB CREDO	0.723	0.064	0.524	0.008
Rv0410c_2pzi_A	9	3ri5_IVM_D_349 PDB CREDO	0.696	0.084	0.524	0.008
Rv0410c.1	10	2vn1_FK5_A_501 PDB CREDO	0.587	0.195	0.524	0.008
Rv0410c_2pzi_A	2	2ya7_ZMR_C_1776 PDB CREDO	0.524	0.282	0.524	0.008
Rv0410c_2pzi_A	9	3rif_IVM_E_402 PDB CREDO	0.695	0.085	0.523	0.008
Rv0410c.2	12	3hec_STI_A_1 PDB CREDO	0.574	0.212	0.523	0.008
Rv0410c_2pzi_A	2	1a4l_DCF_A_353 PDB CREDO	0.581	0.203	0.523	0.008
Rv0410c.2	12	3frq_ERY_A_195 PDB CREDO	0.554	0.238	0.522	0.008
Rv0410c_2pzi_A	9	3d91_REM_A_350 PDB CREDO	0.650	0.125	0.522	0.008
Rv0410c_2pzi_A	9	1oq5_CEL_A_701 PDB CREDO	0.620	0.156	0.522	0.008
Rv0410c_2pzi_A	9	3rhw_IVM_B_348 PDB CREDO	0.693	0.086	0.522	0.008
Rv0410c_2pzi_A	9	3rhw_IVM_D_348 PDB CREDO	0.693	0.086	0.522	0.008
Rv0410c_2pzi_A	9	3ria_IVM_A_348 PDB CREDO	0.693	0.086	0.522	0.008
Rv0410c.2	5	3cs9_NIL_C_600 PDB CREDO	0.598	0.181	0.522	0.008
Rv0410c.2	5	3cs9_NIL_D_600 PDB CREDO	0.598	0.181	0.522	0.008
Rv0410c.2	5	3cs9_NIL_B_600 PDB CREDO	0.567	0.221	0.522	0.008
Rv0410c.2	5	3prs_RIT_A_1001 PDB CREDO	0.697	0.083	0.522	0.008
Rv0410c_2pzi_A	9	3ria_IVM_C_350 PDB CREDO	0.692	0.087	0.521	0.008
Rv0410c.2	5	2v0z_C41_O_1327 PDB CREDO	0.613	0.163	0.521	0.008
Rv0410c.2	12	1fm6_BRL_X_504 PDB CREDO	0.589	0.192	0.521	0.008
Rv0410c.2	5	3b0w_DGX_A_1 PDB CREDO	0.568	0.220	0.520	0.008
Rv0410c_2pzi_A	9	3rhw_IVM_D_349 PDB CREDO	0.691	0.088	0.520	0.008
Rv0410c.1	10	1err_RAL_B_600 PDB CREDO	0.587	0.195	0.520	0.008
Rv0410c_2pzi_A	9	3rhw_IVM_B_349 PDB CREDO	0.690	0.088	0.520	0.008
Rv0410c_2pzi_A	9	3frq_ERY_B_195 PDB CREDO	0.572	0.214	0.519	0.008
Rv0410c.2	12	1xkk_FMM_A_91 PDB CREDO	0.705	0.077	0.519	0.008
Rv0410c_2pzi_A	9	3ria_IVM_E_348 PDB CREDO	0.689	0.089	0.519	0.008
Rv0410c.2	12	3d91_REM_B_350 PDB CREDO	0.535	0.266	0.519	0.008
Rv0410c.1	12	4eyb_0WO_A_303 PDB CREDO	0.579	0.206	0.519	0.008
Rv0410c_2pzi_A	9	3ri5_IVM_A_349 PDB CREDO	0.689	0.090	0.519	0.008
Rv0410c_2pzi_A	9	3d91_REM_B_350 PDB CREDO	0.645	0.130	0.518	0.008
Rv0410c.2	12	3d91_REM_A_350 PDB CREDO	0.533	0.268	0.518	0.008
Rv0410c.2	40	1e7b_HLT_A_4003 PDB CREDO	0.700	0.081	0.517	0.008
Rv0410c.1	41	3f78_ICF_A_1 PDB CREDO	0.550	0.243	0.517	0.008
Rv0410c.2	12	2jfa_RAL_A_600 PDB CREDO	0.567	0.221	0.517	0.008
Rv0410c.2	40	4dtz_LDP_A_501 PDB CREDO	0.517	0.293	0.517	0.008
Rv0410c.1	10	1err_RAL_A_600 PDB CREDO	0.582	0.201	0.516	0.009
Rv0410c_2pzi_A	2	4eyb_0WO_A_303 PDB CREDO	0.553	0.239	0.516	0.009
Rv0410c_2pzi_A	9	3rhw_IVM_A_348 PDB CREDO	0.685	0.093	0.516	0.009
Rv0410c_2pzi_A	9	3ria_IVM_E_349 PDB CREDO	0.685	0.093	0.516	0.009
Rv0410c.2	5	1lhv_NOG_A_301 PDB CREDO	0.656	0.119	0.515	0.009
Rv0410c.2	12	2jfa_RAL_B_600 PDB CREDO	0.547	0.248	0.515	0.009
Rv0410c.1	10	2jfa_RAL_B_600 PDB CREDO	0.580	0.203	0.514	0.009
Rv0410c.1	12	1jzs_MRC_A_1301 PDB CREDO	0.534	0.267	0.514	0.009
Rv0410c.2	12	3spk_TPV_B_100 PDB CREDO	0.545	0.251	0.514	0.009
Rv0410c.2	5	2w8y_486_A_1000 PDB CREDO	0.560	0.230	0.513	0.009
Rv0410c.1	10	3b0w_DGX_A_1 PDB CREDO	0.529	0.275	0.513	0.009
Rv0410c.2	5	1tco_FK5_C_509 PDB CREDO	0.636	0.139	0.513	0.009
Rv0410c_2pzi_A	9	1ict_T44_D_129 PDB CREDO	0.736	0.056	0.513	0.009
Rv0410c_2pzi_A	2	2fum_MIX_D_3539 PDB CREDO	0.513	0.299	0.513	0.009
Rv0410c_2pzi_A	2	3k2h_LYA_B_514 PDB CREDO	0.549	0.245	0.513	0.009
Rv0410c.1	10	3heg_BAX_A_1 PDB CREDO	0.544	0.253	0.512	0.009
Rv0410c.2	5	2oiq_STI_A_1001 PDB CREDO	0.576	0.209	0.512	0.009
Rv0410c.2	5	2x9g_LYA_B_1270 PDB CREDO	0.719	0.067	0.512	0.009
Rv0410c.2	5	3tne_RIT_B_401 PDB CREDO	0.631	0.143	0.512	0.009
Rv0410c.1	41	2y7w_SAL_A_1300 PDB CREDO	0.544	0.253	0.512	0.009
Rv0410c.2	12	1err_RAL_A_600 PDB CREDO	0.544	0.253	0.512	0.009
Rv0410c.2	12	1err_RAL_B_600 PDB CREDO	0.544	0.253	0.512	0.009
Rv0410c.1	10	1tco_FK5_C_509 PDB CREDO	0.672	0.104	0.512	0.009
Rv0410c.1	41	1ikv_EFZ_A_2000 PDB CREDO	0.718	0.068	0.511	0.009
Rv0410c.1	10	3b0w_DGX_B_1 PDB CREDO	0.557	0.235	0.511	0.009
Rv0410c_2pzi_A	9	2c49_ADN_A_1301 PDB CREDO	0.704	0.078	0.510	0.009
Rv0410c.2	12	3ln1_CEL_C_682 PDB CREDO	0.595	0.184	0.509	0.009
Rv0410c.2	12	3ut5_LOC_B_502 PDB CREDO	0.525	0.280	0.509	0.009
Rv0410c_2pzi_A	2	4eyb_0WO_B_301 PDB CREDO	0.587	0.195	0.509	0.009
Rv0410c.2	12	3ln1_CEL_A_682 PDB CREDO	0.595	0.185	0.509	0.010
Rv0410c_2pzi_A	9	3f4x_KLT_A_300 PDB CREDO	0.676	0.101	0.509	0.010
Rv0410c_2pzi_A	9	3frq_ERY_A_195 PDB CREDO	0.652	0.123	0.509	0.010
Rv0410c.2	12	3ln1_CEL_B_682 PDB CREDO	0.594	0.186	0.508	0.010
Rv0410c.2	12	1zgy_BRL_A_503 PDB CREDO	0.634	0.140	0.508	0.010
Rv0410c.2	12	3qt0_486_A_4 PDB CREDO	0.656	0.119	0.507	0.010
Rv0410c.2	40	2wek_DIF_A_1375 PDB CREDO	0.507	0.308	0.507	0.010
Rv0410c_2pzi_A	9	1cil_ETS_A_263 PDB CREDO	0.542	0.256	0.507	0.010
Rv0410c_2pzi_A	9	3ri5_IVM_E_349 PDB CREDO	0.727	0.062	0.507	0.010
Rv0410c.1	12	4eyb_0WO_B_301 PDB CREDO	0.526	0.279	0.506	0.010
Rv0410c.2	12	3k5v_STI_A_2 PDB CREDO	0.585	0.197	0.506	0.010
Rv0410c.2	12	1opj_STI_A_3 PDB CREDO	0.601	0.178	0.506	0.010
Rv0410c.2	12	3oht_1N1_B_1000 PDB CREDO	0.700	0.081	0.505	0.010
Rv0410c.1	10	2w8y_486_A_1000 PDB CREDO	0.520	0.287	0.505	0.010
Rv0410c_2pzi_A	9	2oax_SNL_C_3001 PDB CREDO	0.556	0.235	0.505	0.010
Rv0410c.2	40	1e7b_HLT_B_4003 PDB CREDO	0.683	0.094	0.505	0.010
Rv0410c.2	12	3bbt_FMM_D_91 PDB CREDO	0.652	0.122	0.505	0.010
Rv0410c.2	40	4a9j_TYL_C_1184 PDB CREDO	0.547	0.249	0.505	0.010
Rv0410c.2	5	1xkk_FMM_A_91 PDB CREDO	0.610	0.168	0.504	0.010
Rv0410c_2pzi_A	9	3mne_DEX_A_784 PDB CREDO	0.521	0.286	0.504	0.010
Rv0410c_2pzi_A	9	3vhu_SNL_A_1001 PDB CREDO	0.556	0.236	0.504	0.010
Rv0410c_2pzi_A	2	2ya7_ZMR_D_1776 PDB CREDO	0.560	0.230	0.504	0.010
Rv0410c.1	10	2x9g_LYA_A_1270 PDB CREDO	0.606	0.172	0.504	0.010
Rv0410c_2pzi_A	9	3gn8_DEX_B_247 PDB CREDO	0.521	0.286	0.504	0.010
Rv0410c_2pzi_A	9	2ab2_SNL_A_502 PDB CREDO	0.555	0.238	0.503	0.010
Rv0410c.2	40	4du2_LDP_A_501 PDB CREDO	0.503	0.313	0.503	0.010
Rv0410c.2	12	3q70_RIT_A_2001 PDB CREDO	0.503	0.314	0.503	0.010
Rv0410c.2	12	3vn2_TLS_A_501 PDB CREDO	0.535	0.266	0.503	0.010
Rv0410c_2pzi_A	9	1z2b_VLB_C_800 PDB CREDO	0.608	0.170	0.503	0.010
Rv0410c.2	12	3spk_TPV_A_100 PDB CREDO	0.628	0.147	0.502	0.011
Rv0410c_2pzi_A	9	2oax_SNL_B_2001 PDB CREDO	0.554	0.239	0.502	0.011
Rv0410c_2pzi_A	9	2aa6_STR_A_401 PDB CREDO	0.502	0.315	0.502	0.011
Rv0410c_2pzi_A	2	2zi9_CL9_A_401 PDB CREDO	0.578	0.206	0.502	0.011
Rv0410c_2pzi_A	9	2ab2_SNL_B_503 PDB CREDO	0.553	0.240	0.502	0.011
Rv0410c.2	5	2gqg_1N1_B_502 PDB CREDO	0.681	0.096	0.502	0.011
Rv0410c.1	12	1d4f_ADN_D_604 PDB CREDO	0.502	0.316	0.502	0.011
Rv0410c.1	10	2jfa_RAL_A_600 PDB CREDO	0.584	0.199	0.502	0.011
Rv0410c.2	12	2nni_MTK_A_501 PDB CREDO	0.532	0.269	0.502	0.011
Rv0410c.2	12	2qxs_RAL_A_600 PDB CREDO	0.613	0.164	0.502	0.011
Rv0410c_2pzi_A	9	1fr6_AZR_A_362 PDB CREDO	0.666	0.109	0.502	0.011
Rv0410c_2pzi_A	9	1p93_DEX_D_4999 PDB CREDO	0.518	0.291	0.501	0.011
Rv0410c.2	12	3h52_486_B_1 PDB CREDO	0.501	0.317	0.501	0.011
Rv0410c.2	12	3v5w_8PR_A_701 PDB CREDO	0.586	0.196	0.501	0.011
Rv0410c_2pzi_A	9	1p93_DEX_C_3999 PDB CREDO	0.517	0.291	0.501	0.011
Rv0410c.2	12	3oct_1N1_A_663 PDB CREDO	0.670	0.106	0.501	0.011
Rv0410c_2pzi_A	9	2aax_PDN_A_502 PDB CREDO	0.501	0.318	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

View results in TIBLE page

Name	Affinity	Assay description	DOI
CHEMBL2017707	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017708	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017709	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017710	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017711	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017712	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017713	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017714	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017715	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017716	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017717	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017718	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017719	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017720	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017721	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017722	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017723	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017724	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017725	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017726	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017727	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017728	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017729	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017730	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017731	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017732	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017733	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017734	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017735	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017736	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017737	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017738	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017739	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017870	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2017871	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702
CHEMBL2070289	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070289	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070289	Inhibition = 13 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070289	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070289	Inhibition = 23 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070289	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070290	Inhibition = 43 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070290	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070290	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070290	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070290	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070291	Inhibition = 11 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070292	Inhibition = 4 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070293	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070294	Inhibition = 17 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070295	Inhibition = 11 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 37 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 14 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 18 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 4 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070296	Inhibition = 29 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070297	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070297	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070297	Inhibition = 53 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070297	Inhibition = 4 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070297	Inhibition = 19 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070298	Inhibition = 12 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 43 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 10 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 6 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 9 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070299	Inhibition = 43 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 28 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 16 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070300	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 35 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 7 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 11 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 9 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070301	Inhibition = 25 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070302	Inhibition = 9 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070302	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070302	Inhibition = 17 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070302	Inhibition = 41 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 19 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070303	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070304	Inhibition = 5 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 2 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 6.25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 34 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 0 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 3.125 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070305	Inhibition = 3 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070306	Inhibition = 12 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 12.5 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070306	Inhibition = 38 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 100 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070306	Inhibition = 24 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 50 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL2070306	Inhibition = 22 %	Inhibition of Mycobacterium tuberculosis recombinant PKnG expressed in Escherichia coli BL21 (DE3) cells using myelin basic protein substrate at 25 uM by luciferase activity based ADP-Glo-luminescent kinase assay	http://www.ncbi.nlm.nih.gov/pubmed/22854194
CHEMBL379367	Active	Inhibition of Mycobacterium tuberculosis Protein kinase G by radiometric ATP consumptive assay	http://www.ncbi.nlm.nih.gov/pubmed/17616581
CHEMBL549536	Active	Inhibition of Mycobacterium tuberculosis PknG	http://www.ncbi.nlm.nih.gov/pubmed/22469702

Off-target activity - ligand based from TIBLE

View results in TIBLE page

Predicted off-target	Method	Summary	Full results
None	None	no_bind	Link

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Target name	CHEMBL ID	SMILES
Plk1(PBD)	CC(C)C1=CC(=O)C(C)=CC1=O
Plk1(PBD)	CC(C)C1=CC(=N/O)C(C)=CC1=O

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
AxxPubChem	0.979	264.343
chloridePubChem	0.9	35.453
cadmiumPubChem	0.9	232.515
glycerolPubChem	0.9	92.0938