SInCRe - Rv0157

Tuberculist information

Gene name	pntB
Protein function	Probable NAD(P) transhydrogenase (subunit beta) PntB [integral membrane protein] (pyridine nucleotide transhydrogenase subunit beta) (nicotinamide nucleotide transhydrogenase subunit beta)
Functional category(tuberculist)	intermediary metabolism and respiration
Gene location(kb)	185.052
Molecular mass(da)	48858.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 475

	  		  	1    MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIAVAATLVMIRHTSQWP   60
			  	61   LIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIALSEFIDTTGFSAFQHG  120
			  	121  ESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGLGKAQQPINLLLLAVAVA  180
			  	181  AAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGADMPVVISMLNAMTGLSAA  240
			  	241  AAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIVAGGFGGGGVAPSGGGDDKH  300
			  	301  VKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLATLLEDRGVPVKYAIHPVAGR  360
			  	361  MPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIGANDVTNPAARNETSSPIYGMP  420
			  	421  ILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLFGDAKKSVTEVSEELKAL

Known structures in the PDB

No Known structures

Number of amino acids : 475

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
PNTB	PF02233	5-472

Mtb Structural Proteome models

Model Number	1
Model name	Rv0157
Template	1PNO APDB CREDO
Template coverage	285_464
Template Identity(%)	57.2
Model coverage(%)	37.7
Normalized DOPE score	-1.408

Model Number	2
Model name	Rv0157.1
Template	1L7V APDB CREDO
Template coverage	54_321
Template Identity(%)	19.0
Model coverage(%)	59.6
Normalized DOPE score	0.94

Structure Models from Chopin

Model Number	1
Profile	c.31.1.4 - 3.40.50.1220 Click for model details
zscore	50.93
Residue begin	296
Residue end	475

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0157	Gene name	Confidence Score
Rv0155	pntAa	0.999
Rv0155	pntAa	0.999
Rv0156	pntAb	0.999
Rv1695	ppnK	0.926

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0157.1	5	3rhw_IVM_A_348 PDB CREDO	0.685	0.093	0.685	0.000
Rv0157.1	5	3ria_IVM_E_349 PDB CREDO	0.684	0.093	0.684	0.000
Rv0157.1	5	3ri5_IVM_A_349 PDB CREDO	0.682	0.095	0.682	0.000
Rv0157.1	5	1jg3_ADN_A_500 PDB CREDO	0.724	0.064	0.671	0.000
Rv0157.1	5	2ito_IRE_A_2020 PDB CREDO	0.665	0.110	0.665	0.001
Rv0157.1	5	3bbt_FMM_B_91 PDB CREDO	0.664	0.111	0.664	0.001
Rv0157.1	5	3rhw_IVM_B_348 PDB CREDO	0.660	0.115	0.660	0.001
Rv0157.1	5	3rhw_IVM_B_349 PDB CREDO	0.660	0.115	0.660	0.001
Rv0157.1	5	3rif_IVM_E_402 PDB CREDO	0.660	0.115	0.660	0.001
Rv0157.1	5	1jg3_ADN_B_550 PDB CREDO	0.685	0.093	0.659	0.001
Rv0157.1	5	3rhw_IVM_D_348 PDB CREDO	0.659	0.116	0.659	0.001
Rv0157.1	5	3rhw_IVM_D_349 PDB CREDO	0.659	0.116	0.659	0.001
Rv0157.1	5	3ri5_IVM_B_349 PDB CREDO	0.657	0.117	0.657	0.001
Rv0157.1	5	3ri5_IVM_D_349 PDB CREDO	0.657	0.117	0.657	0.001
Rv0157.1	5	3ria_IVM_C_350 PDB CREDO	0.657	0.117	0.657	0.001
Rv0157.1	5	3ria_IVM_E_348 PDB CREDO	0.657	0.117	0.657	0.001
Rv0157.1	5	3ria_IVM_A_348 PDB CREDO	0.657	0.118	0.657	0.001
Rv0157.1	5	3rif_IVM_A_403 PDB CREDO	0.730	0.060	0.653	0.001
Rv0157.1	5	1jg2_ADN_A_500 PDB CREDO	0.780	0.033	0.650	0.001
Rv0157.1	5	3ri5_IVM_C_350 PDB CREDO	0.714	0.070	0.639	0.001
Rv0157.1	5	3rif_IVM_D_402 PDB CREDO	0.713	0.071	0.638	0.001
Rv0157.1	5	2ity_IRE_A_2020 PDB CREDO	0.689	0.089	0.638	0.001
Rv0157.1	5	3rif_IVM_B_403 PDB CREDO	0.713	0.071	0.638	0.001
Rv0157.1	5	3ria_IVM_C_349 PDB CREDO	0.712	0.072	0.637	0.001
Rv0157.1	5	3rif_IVM_A_402 PDB CREDO	0.711	0.072	0.636	0.001
Rv0157.1	5	3ads_IMN_B_3 PDB CREDO	0.806	0.023	0.632	0.001
Rv0157.1	5	3bbt_FMM_D_91 PDB CREDO	0.780	0.033	0.628	0.001
Rv0157.1	9	3ret_SAL_B_201 PDB CREDO	0.623	0.152	0.623	0.001
Rv0157.1	5	1ie4_T44_B_328 PDB CREDO	0.646	0.129	0.621	0.001
Rv0157.1	5	3oht_1N1_A_1000 PDB CREDO	0.644	0.130	0.621	0.001
Rv0157.1	5	3adx_IMN_B_3 PDB CREDO	0.698	0.082	0.620	0.001
Rv0157.1	9	3ret_SAL_A_201 PDB CREDO	0.620	0.156	0.620	0.001
Rv0157.1	9	3hgx_SAL_B_104 PDB CREDO	0.619	0.157	0.619	0.001
Rv0157.1	5	3ri5_IVM_E_349 PDB CREDO	0.662	0.113	0.612	0.002
Rv0157.1	9	3hgx_SAL_A_102 PDB CREDO	0.611	0.166	0.611	0.002
Rv0157.1	5	2itz_IRE_A_2021 PDB CREDO	0.675	0.101	0.600	0.002
Rv0157.1	5	3oht_1N1_B_1000 PDB CREDO	0.689	0.089	0.595	0.002
Rv0157.1	5	3sxr_1N1_A_1 PDB CREDO	0.638	0.137	0.590	0.003
Rv0157.1	5	3spk_TPV_A_100 PDB CREDO	0.752	0.047	0.585	0.003
Rv0157.1	5	1ie4_T44_A_128 PDB CREDO	0.677	0.100	0.578	0.003
Rv0157.1	5	3sxr_1N1_B_2 PDB CREDO	0.639	0.135	0.568	0.004
Rv0157.1	5	1rv7_AB1_B_1001 PDB CREDO	0.665	0.110	0.567	0.004
Rv0157.1	5	3e22_LOC_D_700 PDB CREDO	0.828	0.016	0.566	0.004
Rv0157.1	5	3e22_LOC_B_700 PDB CREDO	0.827	0.016	0.565	0.004
Rv0157.1	5	2uxo_TAC_B_1211 PDB CREDO	0.629	0.146	0.560	0.004
Rv0157.1	5	3ut5_LOC_D_502 PDB CREDO	0.818	0.019	0.559	0.004
Rv0157.1	9	3ug2_IRE_A_1 PDB CREDO	0.682	0.096	0.554	0.005
Rv0157.1	5	3k54_1N1_A_1 PDB CREDO	0.597	0.183	0.554	0.005
Rv0157.1	5	1ya3_STR_C_3001 PDB CREDO	0.594	0.186	0.552	0.005
Rv0157.1	5	1mx1_THA_C_3 PDB CREDO	0.636	0.139	0.549	0.005
Rv0157.1	5	1ya4_CTX_C_3 PDB CREDO	0.591	0.189	0.547	0.005
Rv0157.1	9	3vkx_T3_A_301 PDB CREDO	0.707	0.075	0.547	0.005
Rv0157.1	5	1mx1_THA_D_4 PDB CREDO	0.591	0.190	0.546	0.005
Rv0157.1	5	1ict_T44_C_128 PDB CREDO	0.639	0.136	0.545	0.005
Rv0157.1	5	1ict_T44_D_129 PDB CREDO	0.587	0.194	0.544	0.006
Rv0157.1	5	3f4x_KLT_A_300 PDB CREDO	0.544	0.253	0.544	0.006
Rv0157.1	5	3h52_486_C_4 PDB CREDO	0.607	0.170	0.544	0.006
Rv0157.1	5	1sa1_POD_D_701 PDB CREDO	0.871	0.007	0.543	0.006
Rv0157.1	9	3rem_SAL_B_301 PDB CREDO	0.634	0.141	0.541	0.006
Rv0157.1	5	2xkw_P1B_B_1475 PDB CREDO	0.604	0.174	0.541	0.006
Rv0157.1	5	1mx1_THA_E_5 PDB CREDO	0.582	0.201	0.540	0.006
Rv0157.1	5	1sn5_T3_C_601 PDB CREDO	0.660	0.115	0.540	0.006
Rv0157.1	5	1ya4_CTX_B_2 PDB CREDO	0.584	0.199	0.540	0.006
Rv0157.1	5	1mx1_THA_F_6 PDB CREDO	0.583	0.200	0.539	0.006
Rv0157.1	9	3gvu_STI_A_1002 PDB CREDO	0.538	0.262	0.538	0.006
Rv0157.1	5	3ut5_LOC_B_502 PDB CREDO	0.835	0.014	0.537	0.006
Rv0157.1	5	3qlg_1N1_A_601 PDB CREDO	0.557	0.234	0.536	0.006
Rv0157.1	5	3qlg_1N1_B_601 PDB CREDO	0.557	0.235	0.536	0.006
Rv0157.1	5	1s9p_DES_A_459 PDB CREDO	0.620	0.156	0.535	0.006
Rv0157.1	5	3lfa_1N1_A_361 PDB CREDO	0.653	0.121	0.535	0.006
Rv0157.1	5	1ya3_STR_B_2001 PDB CREDO	0.642	0.133	0.535	0.006
Rv0157.1	5	1ya3_STR_A_1001 PDB CREDO	0.640	0.134	0.534	0.007
Rv0157.1	5	3g5d_1N1_B_1 PDB CREDO	0.554	0.238	0.533	0.007
Rv0157.1	9	3rem_SAL_A_301 PDB CREDO	0.625	0.151	0.533	0.007
Rv0157.1	5	1m17_AQ4_A_999 PDB CREDO	0.623	0.152	0.532	0.007
Rv0157.1	5	3g5d_1N1_A_1 PDB CREDO	0.551	0.243	0.530	0.007
Rv0157.1	5	1sa1_POD_B_700 PDB CREDO	0.874	0.006	0.529	0.007
Rv0157.1	9	3fl9_TOP_F_200 PDB CREDO	0.559	0.232	0.529	0.007
Rv0157.1	9	3jw3_TOP_A_208 PDB CREDO	0.559	0.232	0.529	0.007
Rv0157.1	5	2h42_VIA_A_901 PDB CREDO	0.655	0.119	0.528	0.007
Rv0157.1	9	3fl9_TOP_C_200 PDB CREDO	0.557	0.234	0.528	0.007
Rv0157.1	9	3jwq_VIA_C_901 PDB CREDO	0.617	0.159	0.527	0.007
Rv0157.1	5	3kw2_ADN_B_300 PDB CREDO	0.569	0.218	0.527	0.007
Rv0157.1	9	2w9g_TOP_A_1159 PDB CREDO	0.526	0.279	0.526	0.007
Rv0157.1	5	2h42_VIA_C_903 PDB CREDO	0.584	0.198	0.523	0.008
Rv0157.1	5	1sn0_T44_C_601 PDB CREDO	0.725	0.063	0.521	0.008
Rv0157.1	5	3q1e_T44_C_128 PDB CREDO	0.521	0.286	0.521	0.008
Rv0157.1	9	2w9s_TOP_B_1160 PDB CREDO	0.521	0.286	0.521	0.008
Rv0157.1	9	3b2r_VDN_A_1 PDB CREDO	0.770	0.037	0.518	0.008
Rv0157.1	5	1g50_EST_A_600 PDB CREDO	0.583	0.200	0.518	0.008
Rv0157.1	9	3fl9_TOP_G_200 PDB CREDO	0.575	0.210	0.517	0.008
Rv0157.1	9	3fl9_TOP_D_200 PDB CREDO	0.546	0.250	0.517	0.008
Rv0157.1	9	3b2r_VDN_B_1 PDB CREDO	0.764	0.040	0.514	0.009
Rv0157.1	5	3jwq_VIA_D_901 PDB CREDO	0.638	0.137	0.514	0.009
Rv0157.1	9	3rf4_FUN_C_203 PDB CREDO	0.601	0.178	0.513	0.009
Rv0157.1	5	3cs8_BRL_A_503 PDB CREDO	0.553	0.240	0.512	0.009
Rv0157.1	5	3uud_EST_A_600 PDB CREDO	0.576	0.210	0.512	0.009
Rv0157.1	5	3uud_EST_B_600 PDB CREDO	0.576	0.210	0.512	0.009
Rv0157.1	5	1p93_DEX_A_1999 PDB CREDO	0.635	0.140	0.511	0.009
Rv0157.1	5	3ols_EST_B_600 PDB CREDO	0.575	0.211	0.511	0.009
Rv0157.1	9	3rf4_FUN_A_201 PDB CREDO	0.598	0.182	0.510	0.009
Rv0157.1	9	3fl9_TOP_B_200 PDB CREDO	0.568	0.220	0.510	0.009
Rv0157.1	5	2xn7_T44_A_1355 PDB CREDO	0.573	0.213	0.509	0.009
Rv0157.1	5	2xpv_MIY_A_1209 PDB CREDO	0.590	0.191	0.509	0.009
Rv0157.1	9	3rf4_FUN_B_202 PDB CREDO	0.596	0.184	0.509	0.009
Rv0157.1	9	2w9s_TOP_A_1160 PDB CREDO	0.566	0.222	0.509	0.010
Rv0157.1	9	3jwq_VIA_A_901 PDB CREDO	0.566	0.222	0.509	0.010
Rv0157.1	5	1nhz_486_A_800 PDB CREDO	0.653	0.121	0.508	0.010
Rv0157.1	5	2yja_EST_B_1550 PDB CREDO	0.571	0.215	0.508	0.010
Rv0157.1	5	1p93_DEX_B_2999 PDB CREDO	0.631	0.144	0.508	0.010
Rv0157.1	9	3hm1_J3Z_A_2 PDB CREDO	0.719	0.067	0.506	0.010
Rv0157.1	9	2w9s_TOP_C_1160 PDB CREDO	0.563	0.226	0.506	0.010
Rv0157.1	9	3fl9_TOP_A_200 PDB CREDO	0.563	0.226	0.506	0.010
Rv0157.1	5	2aa6_STR_B_402 PDB CREDO	0.672	0.104	0.506	0.010
Rv0157.1	9	3fl9_TOP_E_200 PDB CREDO	0.535	0.265	0.506	0.010
Rv0157.1	5	3ols_EST_A_600 PDB CREDO	0.569	0.218	0.506	0.010
Rv0157.1	5	2q1v_PDN_A_248 PDB CREDO	0.606	0.172	0.505	0.010
Rv0157.1	9	3jw5_TOP_B_208 PDB CREDO	0.562	0.228	0.505	0.010
Rv0157.1	5	3erd_DES_B_800 PDB CREDO	0.563	0.226	0.504	0.010
Rv0157.1	5	2aa6_STR_A_401 PDB CREDO	0.669	0.106	0.504	0.010
Rv0157.1	5	3so9_017_A_100 PDB CREDO	0.784	0.031	0.503	0.010
Rv0157.1	5	3oct_1N1_A_663 PDB CREDO	0.603	0.175	0.503	0.010
Rv0157.1	5	2w8y_NDR_B_1000 PDB CREDO	0.543	0.254	0.502	0.011
Rv0157.1	9	3jw5_TOP_A_208 PDB CREDO	0.559	0.232	0.502	0.011
Rv0157.1	5	2aax_PDN_A_502 PDB CREDO	0.665	0.110	0.501	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

Chemical Name	Confidence score	Molecular Weight
NADPPubChem	0.992	744.413
NADP(H)PubChem	0.992	745.421
NAD+PubChem	0.988	663.425
reduced nicotinamide adenine dinucleotidePubChem	0.911	665.441
dihydronicotinamide formycin dinucleotidePubChem	0.9	665.441
glycerolPubChem	0.773	92.0938
sulfatePubChem	0.742	96.0626
hydron sulfatePubChem	0.742	196.157
ADP-ribosePubChem	0.702	559.316