SInCRe - Rv0101

Tuberculist information

Gene name	nrp
Protein function	Probable peptide synthetase Nrp (peptide synthase)
Functional category(tuberculist)	lipid metabolism
Gene location(kb)	110.001
Molecular mass(da)	269377
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 2512

	  		  	1    VHRVRLSRSQRNLYNGVRQDNNPALYLIGKSYRFRRLELARFLAALHATVLDNPVQLCVL   60
			  	61   ENSGADYPDLVPRLRFGDIVRVGSADEHLQSTWCSGILGKPLVRHTVHTDPNGYVTGLDV  120
			  	121  HTHHILLDGGATGTIEADLARYLTTDPAGETPSVGAGLAKLREAHRRETAKVEESRGRLS  180
			  	181  AVVQRELADEAYHGGHGHSVSDAPGTAAKGVLHESATICGNAFDAILTLSEAQRVPLNVL  240
			  	241  VAAAAVAVDASLRQNTETLLVHTVDNRFGDSDLNVATCLVNSVAQTVRFPPFASVSDVVR  300
			  	301  TLDRGYVKAVRRRWLREEHYRRMYLAINRTSHVEALTLNFIREPCAPGLRPFLSEVPIAT  360
			  	361  DIGPVEGMTVASVLDEEQRTLNLAIWNRADLPACKTHPKVAERIAAALESMAAMWDRPIA  420
			  	421  MIVNDWFGIGPDGTRCQGDWPARQPSTPAWFLDSARGVHQFLGRRRFVYPWVAWLVQRGA  480
			  	481  APGDVLVFTDDDTDKTIDLLIACHLAGCGYSVCDTADEISVRTNAITEHGDGILVTVVDV  540
			  	541  AATQLAVVGHDELRKVVDERVTQVTHDALLATKTAYIMPTSGTTGQPKLVRISHGSLAVF  600
			  	601  CDAISRAYGWGAHDTVLQCAPLTSDISVEEIFGGAACGARLVRSAAMKTGDLAALVDDLV  660
			  	661  ARETTIVDLPTAVWQLLCADGDAIDAIGRSRLRQIVIGGEAIRCSAVDKWLESAASQGIS  720
			  	721  LLSSYGPTEATVVATFLPIVCDQTTMDGALLRLGRPILPNTVFLAFGEVVIVGDLVADGY  780
			  	781  LGIDGDGFGTVTAADGSRRRAFATGDRVTVDAEGFPVFSGRKDAVVKISGKRVDIAEVTR  840
			  	841  RIAEDPAVSDVAVELHSGSLGVWFKSQRTREGEQDAAAATRIRLVLVSLGVSSFFVVGVP  900
			  	901  NIPRKPNGKIDSDNLPRLPQWSAAGLNTAETGQRAAGLSQIWSRQLGRAIGPDSSLLGEG  960
			  	961  IGSLDLIRILPETRRYLGWRLSLLDLIGADTAANLADYAPTPDAPTGEDRFRPLVAAQRP 1020
			  	1021 AAIPLSFAQRRLWFLDQLQRPAPVYNMAVALRLRGYLDTEALGAAVADVVGRHESLRTVF 1080
			  	1081 PAVDGVPRQLVIEARRADLGCDIVDATAWPADRLQRAIEEAARHSFDLATEIPLRTWLFR 1140
			  	1141 IADDEHVLVAVAHHIAADGWSVAPLTADLSAAYASRCAGRAPDWAPLPVQYVDYTLWQRE 1200
			  	1201 ILGDLDDSDSPIAAQLAYWENALAGMPERLRLPTARPYPPVADQRGASLVVDWPASVQQQ 1260
			  	1261 VRRIARQHNATSFMVVAAGLAVLLSKLSGSPDVAVGFPIAGRSDPALDNLVGFFVNTLVL 1320
			  	1321 RVNLAGDPSFAELLGQVRARSLAAYENQDVPFEVLVDRLKPTRALTHHPLIQVMLAWQDN 1380
			  	1381 PVGQLNLGDLQATPMPIDTRTARMDLVFSLAERFSEGSEPAGIGGAVEYRTDVFEAQAID 1440
			  	1441 VLIERLRKVLVAVAAAPERTVSSIDALDGTERARLDEWGNRAVLTAPAPTPVSIPQMLAA 1500
			  	1501 QVARIPEAEAVCCGDASMTYRELDEASNRLAHRLAGCGAGPGECVALLFERCAPAVVAMV 1560
			  	1561 AVLKTGAAYLPIDPANPPPRVAFMLGDAVPVAAVTTAGLRSRLAGHDLPIIDVVDALAAY 1620
			  	1621 PGTPPPMPAAVNLAYILYTSGTTGEPKGVGITHRNVTRLFASLPARLSAAQVWSQCHSYG 1680
			  	1681 FDASAWEIWGALLGGGRLVIVPESVAASPNDFHGLLVAEHVSVLTQTPAAVAMLPTQGLE 1740
			  	1741 SVALVVAGEACPAALVDRWAPGRVMLNAYGPTETTICAAISAPLRPGSGMPPIGVPVSGA 1800
			  	1801 ALFVLDSWLRPVPAGVAGELYIAGAGVGVGYWRRAGLTASRFVACPFGGSGARMYRTGDL 1860
			  	1861 VCWRADGQLEFLGRTDDQVKIRGYRIELGEVATALAELAGVGQAVVIAREDRPGDKRLVG 1920
			  	1921 YATEIAPGAVDPAGLRAQLAQRLPGYLVPAAVVVIDALPLTVNGKLDHRALPAPEYGDTN 1980
			  	1981 GYRAPAGPVEKTVAGIFARVLGLERVGVDDSFFELGGDSLAAMRVIAAINTTLNADLPVR 2040
			  	2041 ALLHASSTRGLSQLLGRDARPTSDPRLVSVHGDNPTEVHASDLTLDRFIDADTLATAVNL 2100
			  	2101 PGPSPELRTVLLTGATGFLGRYLVLELLRRLDVDGRLICLVRAESDEDARRRLEKTFDSG 2160
			  	2161 DPELLRHFKELAADRLEVVAGDKSEPDLGLDQPMWRRLAETVDLIVDSAAMVNAFPYHEL 2220
			  	2221 FGPNVAGTAELIRIALTTKLKPFTYVSTADVGAAIEPSAFTEDADIRVISPTRTVDGGWA 2280
			  	2281 GGYGTSKWAGEVLLREANDLCALPVAVFRCGMILADTSYAGQLNMSDWVTRMVLSLMATG 2340
			  	2341 IAPRSFYEPDSEGNRQRAHFDGLPVTFVAEAIAVLGARVAGSSLAGFATYHVMNPHDDGI 2400
			  	2401 GLDEYVDWLIEAGYPIRRIDDFAEWLQRFEASLGALPDRQRRHSVLPMLLASNSQRLQPL 2460
			  	2461 KPTRGCSAPTDRFRAAVRAAKVGSDKDNPDIPHVSAPTIINYVTNLQLLGLL

Known structures in the PDB

	PDB ID	4DQV
	Total residue count	478
	Number of chains	1
	Method	X-RAY
	Resolution	2.3

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
AMP-binding	PF00501	470-853
PP-binding	PF00550	936-999
Condensation	PF00668	1020-1325
HxxPF_rpt	PF13745	1346-1442
AMP-binding	PF00501	1498-1882
AMP-binding_C	PF13193	1890-1965
PP-binding	PF00550	1991-2055
NAD_binding_4	PF07993	2112-2372

Mtb Structural Proteome models

Model Number	1
Model name	Rv0101.3
Template	1DNY APDB CREDO
Template coverage	8_83
Template Identity(%)	29.3
Model coverage(%)	2.9
Normalized DOPE score	-0.801

Model Number	2
Model name	Rv0101.9
Template	1DNY APDB CREDO
Template coverage	8_79
Template Identity(%)	38.9
Model coverage(%)	2.8
Normalized DOPE score	-0.707

Model Number	3
Model name	Rv0101
Template	1AMU APDB CREDO
Template coverage	18_529
Template Identity(%)	32.3
Model coverage(%)	20.3
Normalized DOPE score	-0.515

Model Number	4
Model name	Rv0101.2
Template	1AMU APDB CREDO
Template coverage	44_529
Template Identity(%)	20.4
Model coverage(%)	19.3
Normalized DOPE score	0.043

Model Number	5
Model name	Rv0101.5
Template	1L5A APDB CREDO
Template coverage	1_407
Template Identity(%)	19.2
Model coverage(%)	17.2
Normalized DOPE score	0.166

Model Number	6
Model name	Rv0101.6
Template	1PG4 APDB CREDO
Template coverage	5_644
Template Identity(%)	20.5
Model coverage(%)	22.9
Normalized DOPE score	0.3

Model Number	7
Model name	Rv0101.1
Template	1RY2 APDB CREDO
Template coverage	75_713
Template Identity(%)	17.0
Model coverage(%)	21.8
Normalized DOPE score	0.402

Model Number	8
Model name	Rv0101.4
Template	1Q9J APDB CREDO
Template coverage	3_414
Template Identity(%)	15.7
Model coverage(%)	17.8
Normalized DOPE score	0.898

Model Number	9
Model name	Rv0101.8
Template	1Z7E APDB CREDO
Template coverage	16_654
Template Identity(%)	13.1
Model coverage(%)	23.6
Normalized DOPE score	1.022

Structure Models from Chopin

Model Number	1
Profile	e.23.1.1 Click for model details
zscore	25.84
Residue begin	470
Residue end	853

Model Number	2
Profile	e.23.1.1 Click for model details
zscore	25.84
Residue begin	1519
Residue end	1902

Model Number	3
Profile	c.43.1.2 Click for model details
zscore	23.39
Residue begin	1024
Residue end	1204

Model Number	4
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	11.24
Residue begin	1
Residue end	64

Model Number	5
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	11.24
Residue begin	936
Residue end	999

Model Number	6
Profile	a.28.1.2 - 1.10.1200.10 Click for model details
zscore	11.24
Residue begin	1991
Residue end	2054

Model Number	7
Profile	a.80.1.2 Click for model details
zscore	4.26
Residue begin	2125
Residue end	2370

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv0101	Gene name	Confidence Score
Rv0096	PPE1	0.963
Rv0100	Rv0100	0.96
Rv0097	Rv0097	0.957
Rv0098	fcoT	0.957
Rv2377c	mbtH	0.901

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv0101.1	31	3heg_BAX_A_1 PDB CREDO	0.706	0.076	0.685	0.000
Rv0101.1	31	4asd_BAX_A_1500 PDB CREDO	0.683	0.094	0.683	0.000
Rv0101.1	31	3gcs_BAX_A_401 PDB CREDO	0.679	0.098	0.679	0.000
Rv0101.1	31	2jfa_RAL_B_600 PDB CREDO	0.740	0.053	0.676	0.000
Rv0101.1	31	1err_RAL_A_600 PDB CREDO	0.731	0.059	0.668	0.001
Rv0101.1	31	2oiq_STI_A_1001 PDB CREDO	0.687	0.091	0.667	0.001
Rv0101.1	31	1err_RAL_B_600 PDB CREDO	0.728	0.061	0.665	0.001
Rv0101.8	5	3frq_ERY_A_195 PDB CREDO	0.703	0.078	0.664	0.001
Rv0101.1	31	2pl0_STI_A_200 PDB CREDO	0.680	0.097	0.660	0.001
Rv0101.8	5	3kk6_CEL_A_701 PDB CREDO	0.793	0.028	0.656	0.001
Rv0101.8	5	2oax_SNL_F_6001 PDB CREDO	0.737	0.055	0.656	0.001
Rv0101.8	5	3h52_486_B_1 PDB CREDO	0.735	0.056	0.654	0.001
Rv0101.8	5	2oax_SNL_D_4001 PDB CREDO	0.734	0.057	0.653	0.001
Rv0101.8	5	3kk6_CEL_B_1701 PDB CREDO	0.710	0.073	0.653	0.001
Rv0101.8	5	2oax_SNL_A_1001 PDB CREDO	0.733	0.058	0.652	0.001
Rv0101.1	31	2jfa_RAL_A_600 PDB CREDO	0.736	0.056	0.651	0.001
Rv0101.5	1	2jfa_RAL_B_600 PDB CREDO	0.672	0.104	0.651	0.001
Rv0101.5	1	3h52_486_A_3 PDB CREDO	0.691	0.087	0.650	0.001
Rv0101.5	1	1err_RAL_B_600 PDB CREDO	0.670	0.106	0.650	0.001
Rv0101.8	5	2oax_SNL_E_5001 PDB CREDO	0.729	0.060	0.649	0.001
Rv0101.5	1	1err_RAL_A_600 PDB CREDO	0.669	0.106	0.649	0.001
Rv0101.1	31	3oez_STI_A_601 PDB CREDO	0.685	0.092	0.646	0.001
Rv0101.8	5	1z2b_VLB_C_800 PDB CREDO	0.725	0.063	0.645	0.001
Rv0101.8	5	3b0w_DGX_A_1 PDB CREDO	0.701	0.080	0.643	0.001
Rv0101.1	31	2hyy_STI_B_600 PDB CREDO	0.661	0.114	0.642	0.001
Rv0101.8	5	3b0w_DGX_B_1 PDB CREDO	0.660	0.115	0.642	0.001
Rv0101.1	31	3cs9_NIL_A_600 PDB CREDO	0.740	0.054	0.641	0.001
Rv0101.1	31	2qxs_RAL_A_600 PDB CREDO	0.760	0.043	0.641	0.001
Rv0101.1	31	2qxs_RAL_B_600 PDB CREDO	0.758	0.044	0.639	0.001
Rv0101.5	6	2xkw_P1B_A_1478 PDB CREDO	0.670	0.105	0.636	0.001
Rv0101.8	5	3h52_486_D_2 PDB CREDO	0.736	0.056	0.635	0.001
Rv0101.1	11	1hwk_117_B_1 PDB CREDO	0.653	0.122	0.634	0.001
Rv0101.5	6	3bjw_SVR_E_503 PDB CREDO	0.667	0.108	0.633	0.001
Rv0101.1	31	3gvu_STI_A_1001 PDB CREDO	0.669	0.107	0.631	0.001
Rv0101.8	10	3ug2_IRE_A_1 PDB CREDO	0.663	0.112	0.630	0.001
Rv0101.1	31	3k5v_STI_B_2 PDB CREDO	0.668	0.108	0.630	0.001
Rv0101.1	31	3cs9_NIL_B_600 PDB CREDO	0.746	0.050	0.629	0.001
Rv0101.9	3	2ito_IRE_A_2020 PDB CREDO	0.652	0.122	0.628	0.001
Rv0101.1	31	3ms9_STI_B_1 PDB CREDO	0.665	0.110	0.628	0.001
Rv0101.5	6	3bjw_SVR_B_501 PDB CREDO	0.644	0.130	0.628	0.001
Rv0101.1	31	3mss_STI_C_1 PDB CREDO	0.665	0.111	0.627	0.001
Rv0101.5	6	3bjw_SVR_F_502 PDB CREDO	0.643	0.131	0.627	0.001
Rv0101.1	31	2hyy_STI_A_600 PDB CREDO	0.664	0.111	0.627	0.001
Rv0101.1	31	3mss_STI_A_1 PDB CREDO	0.664	0.111	0.627	0.001
Rv0101.1	31	3mss_STI_D_1 PDB CREDO	0.664	0.111	0.627	0.001
Rv0101.1	31	3ms9_STI_A_1 PDB CREDO	0.664	0.111	0.626	0.001
Rv0101.1	31	3mss_STI_B_1 PDB CREDO	0.664	0.111	0.626	0.001
Rv0101.1	31	3pyy_STI_B_4 PDB CREDO	0.664	0.111	0.626	0.001
Rv0101.1	31	1iep_STI_A_201 PDB CREDO	0.663	0.112	0.626	0.001
Rv0101.1	31	1opj_STI_A_3 PDB CREDO	0.722	0.065	0.626	0.001
Rv0101.5	6	3bjw_SVR_H_504 PDB CREDO	0.641	0.133	0.625	0.001
Rv0101.8	5	3d91_REM_A_350 PDB CREDO	0.681	0.096	0.625	0.001
Rv0101.8	5	3bjw_SVR_E_503 PDB CREDO	0.697	0.083	0.625	0.001
Rv0101.1	31	2hyy_STI_C_600 PDB CREDO	0.662	0.113	0.624	0.001
Rv0101.1	31	2hyy_STI_D_600 PDB CREDO	0.662	0.113	0.624	0.001
Rv0101.1	31	1iep_STI_B_202 PDB CREDO	0.661	0.114	0.624	0.001
Rv0101.5	1	2jfa_RAL_A_600 PDB CREDO	0.624	0.152	0.624	0.001
Rv0101.5	6	1xkk_FMM_A_91 PDB CREDO	0.640	0.135	0.623	0.001
Rv0101.1	31	3pyy_STI_A_3 PDB CREDO	0.661	0.114	0.623	0.001
Rv0101.8	5	2ab2_SNL_B_503 PDB CREDO	0.767	0.039	0.623	0.001
Rv0101.8	5	3d91_REM_B_350 PDB CREDO	0.679	0.098	0.623	0.001
Rv0101.8	5	2ab2_SNL_A_502 PDB CREDO	0.765	0.040	0.621	0.001
Rv0101.8	5	2oax_SNL_B_2001 PDB CREDO	0.764	0.040	0.620	0.001
Rv0101.1	31	1opj_STI_B_4 PDB CREDO	0.715	0.070	0.619	0.001
Rv0101.8	5	2oax_SNL_C_3001 PDB CREDO	0.762	0.041	0.619	0.001
Rv0101.8	46	3ols_EST_B_600 PDB CREDO	0.643	0.132	0.617	0.002
Rv0101.8	5	3mnp_DEX_A_784 PDB CREDO	0.737	0.056	0.616	0.002
Rv0101.8	5	3mno_DEX_A_784 PDB CREDO	0.735	0.057	0.615	0.002
Rv0101.8	46	1g50_EST_A_600 PDB CREDO	0.639	0.135	0.614	0.002
Rv0101.8	5	3vhu_SNL_A_1001 PDB CREDO	0.756	0.044	0.614	0.002
Rv0101.1	31	3spk_TPV_B_100 PDB CREDO	0.632	0.143	0.613	0.002
Rv0101.5	1	2qxs_RAL_A_600 PDB CREDO	0.821	0.018	0.613	0.002
Rv0101.6	12	1lhv_NOG_A_301 PDB CREDO	0.632	0.142	0.612	0.002
Rv0101.8	46	1ya4_CTX_C_3 PDB CREDO	0.662	0.113	0.611	0.002
Rv0101.1	31	3k5v_STI_A_2 PDB CREDO	0.685	0.092	0.611	0.002
Rv0101.8	46	2yja_EST_B_1550 PDB CREDO	0.636	0.139	0.611	0.002
Rv0101.8	46	3ols_EST_A_600 PDB CREDO	0.636	0.139	0.611	0.002
Rv0101.8	5	3bjw_SVR_H_504 PDB CREDO	0.738	0.055	0.610	0.002
Rv0101.6	6	3r9c_ECL_A_452 PDB CREDO	0.636	0.138	0.610	0.002
Rv0101.8	5	2v0z_C41_O_1327 PDB CREDO	0.717	0.068	0.609	0.002
Rv0101.8	46	3uud_EST_A_600 PDB CREDO	0.634	0.140	0.609	0.002
Rv0101.8	46	3uud_EST_B_600 PDB CREDO	0.634	0.140	0.609	0.002
Rv0101.1	31	1qkn_RAL_A_600 PDB CREDO	0.733	0.058	0.608	0.002
Rv0101.8	5	3bjw_SVR_B_501 PDB CREDO	0.735	0.056	0.608	0.002
Rv0101.1	31	3cs9_NIL_C_600 PDB CREDO	0.761	0.042	0.608	0.002
Rv0101.8	5	3bjw_SVR_F_502 PDB CREDO	0.735	0.057	0.608	0.002
Rv0101.5	1	2qxs_RAL_B_600 PDB CREDO	0.814	0.020	0.608	0.002
Rv0101.8	5	1uwj_BAX_A_1723 PDB CREDO	0.607	0.171	0.607	0.002
Rv0101.9	3	3oht_1N1_A_1000 PDB CREDO	0.607	0.171	0.607	0.002
Rv0101.5	6	1t46_STI_A_3 PDB CREDO	0.622	0.154	0.606	0.002
Rv0101.1	31	3oez_STI_B_601 PDB CREDO	0.684	0.093	0.605	0.002
Rv0101.8	5	3h52_486_A_3 PDB CREDO	0.701	0.080	0.605	0.002
Rv0101.8	5	3frq_ERY_B_195 PDB CREDO	0.745	0.051	0.604	0.002
Rv0101.8	46	1ya4_CTX_B_2 PDB CREDO	0.654	0.121	0.603	0.002
Rv0101.8	46	1xp0_VDN_A_201 PDB CREDO	0.656	0.119	0.603	0.002
Rv0101.5	1	1qkn_RAL_A_600 PDB CREDO	0.643	0.132	0.603	0.002
Rv0101.1	11	1hwk_117_A_2 PDB CREDO	0.657	0.118	0.602	0.002
Rv0101.1	11	1hwl_FBI_D_3 PDB CREDO	0.677	0.099	0.602	0.002
Rv0101.1	31	1uwj_BAX_B_1723 PDB CREDO	0.602	0.176	0.602	0.002
Rv0101.1	16	1uwj_BAX_A_1723 PDB CREDO	0.619	0.157	0.602	0.002
Rv0101.1	11	1hwk_117_C_4 PDB CREDO	0.656	0.118	0.602	0.002
Rv0101.1	11	1hwl_FBI_B_1 PDB CREDO	0.675	0.101	0.601	0.002
Rv0101.9	3	2ity_IRE_A_2020 PDB CREDO	0.674	0.102	0.600	0.002
Rv0101.1	31	3cs9_NIL_D_600 PDB CREDO	0.750	0.048	0.600	0.002
Rv0101.9	3	1jg3_ADN_A_500 PDB CREDO	0.622	0.154	0.599	0.002
Rv0101.1	16	3d91_REM_B_350 PDB CREDO	0.672	0.104	0.599	0.002
Rv0101.1	18	3qlg_1N1_A_601 PDB CREDO	0.597	0.182	0.597	0.002
Rv0101.1	11	1hwl_FBI_C_4 PDB CREDO	0.671	0.105	0.597	0.002
Rv0101.5	6	1uwj_BAX_A_1723 PDB CREDO	0.703	0.079	0.597	0.002
Rv0101.9	3	1ie4_T44_B_328 PDB CREDO	0.644	0.130	0.597	0.002
Rv0101.1	46	1hwk_117_D_3 PDB CREDO	0.635	0.140	0.597	0.002
Rv0101.1	31	2w8y_486_A_1000 PDB CREDO	0.597	0.183	0.597	0.002
Rv0101.9	3	2itz_IRE_A_2021 PDB CREDO	0.696	0.084	0.596	0.002
Rv0101.1	11	1hwl_FBI_A_2 PDB CREDO	0.670	0.106	0.596	0.002
Rv0101.8	46	3bbt_FMM_B_91 PDB CREDO	0.698	0.082	0.596	0.002
Rv0101.1	18	3g5d_1N1_B_1 PDB CREDO	0.596	0.184	0.596	0.002
Rv0101.1	46	1hwi_115_D_3 PDB CREDO	0.596	0.184	0.596	0.002
Rv0101.1	46	1hwi_115_B_1 PDB CREDO	0.595	0.185	0.595	0.002
Rv0101.1	16	3d91_REM_A_350 PDB CREDO	0.666	0.109	0.594	0.002
Rv0101.8	28	3kp6_SAL_A_3005 PDB CREDO	0.638	0.136	0.593	0.002
Rv0101.6	15	2uxp_CLM_B_1211 PDB CREDO	0.592	0.189	0.592	0.002
Rv0101.5	1	1s9p_DES_D_600 PDB CREDO	0.747	0.049	0.592	0.002
Rv0101.1	31	3rgf_BAX_A_465 PDB CREDO	0.645	0.129	0.592	0.002
Rv0101.8	5	1skx_RFP_A_1 PDB CREDO	0.642	0.132	0.591	0.002
Rv0101.8	5	1p93_DEX_D_4999 PDB CREDO	0.776	0.035	0.590	0.003
Rv0101.1	31	1y0x_T44_X_500 PDB CREDO	0.627	0.149	0.590	0.003
Rv0101.1	31	2hw2_RFP_A_1200 PDB CREDO	0.666	0.109	0.590	0.003
Rv0101.8	5	1p93_DEX_C_3999 PDB CREDO	0.775	0.035	0.590	0.003
Rv0101.5	1	3h52_486_D_2 PDB CREDO	0.627	0.148	0.589	0.003
Rv0101.9	4	3oct_1N1_A_663 PDB CREDO	0.589	0.192	0.589	0.003
Rv0101.9	3	1jg3_ADN_B_550 PDB CREDO	0.636	0.139	0.589	0.003
Rv0101.1	18	3qlg_1N1_B_601 PDB CREDO	0.589	0.192	0.589	0.003
Rv0101.8	5	3gn8_DEX_B_247 PDB CREDO	0.774	0.036	0.589	0.003
Rv0101.1	31	3b0w_DGX_B_1 PDB CREDO	0.660	0.115	0.588	0.003
Rv0101.1	11	2nni_MTK_A_501 PDB CREDO	0.623	0.152	0.588	0.003
Rv0101.8	5	3gn8_DEX_A_247 PDB CREDO	0.773	0.036	0.588	0.003
Rv0101.8	5	3mne_DEX_A_784 PDB CREDO	0.773	0.036	0.588	0.003
Rv0101.8	46	1s9p_DES_C_500 PDB CREDO	0.637	0.138	0.587	0.003
Rv0101.1	11	1hwk_117_D_3 PDB CREDO	0.680	0.097	0.587	0.003
Rv0101.5	6	3b0w_DGX_B_1 PDB CREDO	0.672	0.104	0.587	0.003
Rv0101.1	18	3g5d_1N1_A_1 PDB CREDO	0.587	0.195	0.587	0.003
Rv0101.8	46	1s9p_DES_B_459 PDB CREDO	0.636	0.139	0.587	0.003
Rv0101.8	5	1m2z_DEX_A_301 PDB CREDO	0.770	0.037	0.586	0.003
Rv0101.1	31	1uwh_BAX_B_1723 PDB CREDO	0.622	0.154	0.586	0.003
Rv0101.6	7	1uwj_BAX_A_1723 PDB CREDO	0.586	0.197	0.586	0.003
Rv0101.1	31	1uwh_BAX_A_1723 PDB CREDO	0.621	0.154	0.585	0.003
Rv0101.8	5	2v0z_C41_C_1328 PDB CREDO	0.744	0.051	0.585	0.003
Rv0101.1	31	1n49_RIT_D_401 PDB CREDO	0.620	0.156	0.585	0.003
Rv0101.8	10	3r9c_ECL_A_451 PDB CREDO	0.615	0.161	0.585	0.003
Rv0101.9	4	2fum_MIX_D_3539 PDB CREDO	0.604	0.175	0.583	0.003
Rv0101.5	1	3erd_DES_B_800 PDB CREDO	0.763	0.041	0.583	0.003
Rv0101.6	12	3tne_RIT_A_401 PDB CREDO	0.621	0.154	0.583	0.003
Rv0101.2	8	3ubo_ADN_B_353 PDB CREDO	0.583	0.200	0.583	0.003
Rv0101.1	31	3hec_STI_A_1 PDB CREDO	0.658	0.116	0.583	0.003
Rv0101.1	31	3ogp_017_A_200 PDB CREDO	0.600	0.179	0.582	0.003
Rv0101.5	1	3h52_486_B_1 PDB CREDO	0.638	0.136	0.582	0.003
Rv0101.8	10	3jw5_TOP_A_208 PDB CREDO	0.613	0.164	0.582	0.003
Rv0101.8	5	1m2z_DEX_D_401 PDB CREDO	0.765	0.040	0.582	0.003
Rv0101.1	31	3uvv_T3_A_501 PDB CREDO	0.678	0.098	0.582	0.003
Rv0101.8	5	1a28_STR_B_2 PDB CREDO	0.740	0.054	0.581	0.003
Rv0101.6	15	2uxp_CLM_A_1211 PDB CREDO	0.581	0.202	0.581	0.003
Rv0101.8	46	2uxo_TAC_B_1211 PDB CREDO	0.605	0.173	0.581	0.003
Rv0101.8	46	3adx_IMN_B_3 PDB CREDO	0.605	0.173	0.581	0.003
Rv0101.1	31	1uwj_BAX_A_1723 PDB CREDO	0.633	0.142	0.580	0.003
Rv0101.5	1	1a28_STR_B_2 PDB CREDO	0.599	0.181	0.580	0.003
Rv0101.8	10	3jw5_TOP_B_208 PDB CREDO	0.610	0.167	0.579	0.003
Rv0101.8	5	2aa5_STR_B_302 PDB CREDO	0.787	0.030	0.579	0.003
Rv0101.8	5	2aa5_STR_A_301 PDB CREDO	0.785	0.031	0.578	0.003
Rv0101.8	46	1mx1_THA_B_2 PDB CREDO	0.578	0.206	0.578	0.003
Rv0101.8	46	3b2r_VDN_A_1 PDB CREDO	0.687	0.091	0.578	0.003
Rv0101.2	8	3ubo_ADN_A_353 PDB CREDO	0.577	0.207	0.577	0.003
Rv0101.9	4	3k54_1N1_A_1 PDB CREDO	0.642	0.132	0.577	0.003
Rv0101.8	5	2aa6_STR_A_401 PDB CREDO	0.783	0.032	0.577	0.003
Rv0101.8	46	3b2r_VDN_B_1 PDB CREDO	0.685	0.093	0.577	0.003
Rv0101.2	1	4eyb_0WO_A_303 PDB CREDO	0.597	0.182	0.577	0.003
Rv0101.8	46	2w8y_NDR_B_1000 PDB CREDO	0.625	0.150	0.576	0.003
Rv0101.8	5	2h42_VIA_A_901 PDB CREDO	0.836	0.013	0.576	0.003
Rv0101.1	46	1hwk_117_A_2 PDB CREDO	0.650	0.124	0.576	0.003
Rv0101.8	5	2aax_PDN_B_503 PDB CREDO	0.781	0.032	0.575	0.003
Rv0101.1	31	1t46_STI_A_3 PDB CREDO	0.720	0.066	0.575	0.003
Rv0101.1	46	1hwl_FBI_C_4 PDB CREDO	0.631	0.144	0.575	0.003
Rv0101.8	5	2aax_PDN_A_502 PDB CREDO	0.781	0.032	0.575	0.003
Rv0101.1	46	1hwl_FBI_D_3 PDB CREDO	0.630	0.144	0.575	0.003
Rv0101.8	5	2aa6_STR_B_402 PDB CREDO	0.780	0.033	0.575	0.003
Rv0101.1	46	1hwl_FBI_A_2 PDB CREDO	0.630	0.145	0.574	0.003
Rv0101.8	28	3kp6_SAL_B_3007 PDB CREDO	0.618	0.158	0.574	0.003
Rv0101.1	31	1xzx_T3_X_500 PDB CREDO	0.669	0.106	0.574	0.003
Rv0101.9	3	1jg2_ADN_A_500 PDB CREDO	0.662	0.113	0.574	0.003
Rv0101.1	46	1hwl_FBI_B_1 PDB CREDO	0.629	0.146	0.573	0.003
Rv0101.1	31	3gp0_NIL_A_1 PDB CREDO	0.736	0.056	0.573	0.003
Rv0101.9	3	3oht_1N1_B_1000 PDB CREDO	0.639	0.136	0.573	0.003
Rv0101.9	3	1ie4_T44_A_128 PDB CREDO	0.696	0.084	0.572	0.003
Rv0101.8	46	3ads_IMN_B_3 PDB CREDO	0.623	0.153	0.572	0.003
Rv0101.8	5	3vn2_TLS_A_501 PDB CREDO	0.684	0.094	0.572	0.003
Rv0101.3	6	2eva_ADN_A_498 PDB CREDO	0.572	0.214	0.572	0.003
Rv0101.1	46	1hwk_117_C_4 PDB CREDO	0.646	0.129	0.572	0.003
Rv0101.6	13	3n58_ADN_A_500 PDB CREDO	0.633	0.141	0.571	0.004
Rv0101.1	31	1bsx_T3_A_1 PDB CREDO	0.688	0.090	0.571	0.004
Rv0101.1	31	1bsx_T3_B_2 PDB CREDO	0.688	0.090	0.571	0.004
Rv0101.8	5	1y0x_T44_X_500 PDB CREDO	0.660	0.115	0.570	0.004
Rv0101.8	5	2w8y_486_A_1000 PDB CREDO	0.622	0.154	0.570	0.004
Rv0101.8	46	1mx1_THA_D_4 PDB CREDO	0.617	0.159	0.569	0.004
Rv0101.6	12	2x9g_LYA_A_1270 PDB CREDO	0.588	0.194	0.569	0.004
Rv0101.1	31	1xkk_FMM_A_91 PDB CREDO	0.750	0.048	0.569	0.004
Rv0101.8	5	2nni_MTK_A_501 PDB CREDO	0.603	0.176	0.569	0.004
Rv0101.6	12	3tne_RIT_B_401 PDB CREDO	0.607	0.171	0.569	0.004
Rv0101.8	46	3oll_EST_A_600 PDB CREDO	0.619	0.157	0.569	0.004
Rv0101.8	46	3oll_EST_B_600 PDB CREDO	0.619	0.157	0.569	0.004
Rv0101.1	18	3kw2_ADN_A_300 PDB CREDO	0.614	0.163	0.569	0.004
Rv0101.9	3	3g5d_1N1_B_1 PDB CREDO	0.614	0.163	0.569	0.004
Rv0101.1	18	2zva_1N1_A_513 PDB CREDO	0.591	0.189	0.569	0.004
Rv0101.2	8	1ict_T44_C_128 PDB CREDO	0.618	0.158	0.568	0.004
Rv0101.2	8	4e3a_ADN_A_500 PDB CREDO	0.618	0.158	0.568	0.004
Rv0101.9	3	3bbt_FMM_B_91 PDB CREDO	0.589	0.193	0.567	0.004
Rv0101.8	46	1mx1_THA_A_1 PDB CREDO	0.590	0.191	0.566	0.004
Rv0101.9	4	2fum_MIX_A_539 PDB CREDO	0.608	0.170	0.566	0.004
Rv0101.5	1	3erd_DES_A_600 PDB CREDO	0.741	0.053	0.566	0.004
Rv0101.5	6	1skx_RFP_A_1 PDB CREDO	0.613	0.164	0.566	0.004
Rv0101.5	6	3kk6_CEL_A_701 PDB CREDO	0.580	0.203	0.565	0.004
Rv0101.8	2	2v0z_C41_C_1328 PDB CREDO	0.716	0.069	0.565	0.004
Rv0101.8	5	2hw2_RFP_A_1200 PDB CREDO	0.696	0.084	0.565	0.004
Rv0101.9	4	3kw2_ADN_A_300 PDB CREDO	0.652	0.122	0.564	0.004
Rv0101.6	6	4dta_ADN_A_401 PDB CREDO	0.616	0.160	0.564	0.004
Rv0101.5	6	3kk6_CEL_B_1701 PDB CREDO	0.611	0.166	0.564	0.004
Rv0101.5	1	2w8y_486_A_1000 PDB CREDO	0.637	0.137	0.564	0.004
Rv0101.9	3	3kw2_ADN_A_300 PDB CREDO	0.564	0.225	0.564	0.004
Rv0101.9	3	3qlg_1N1_A_601 PDB CREDO	0.609	0.169	0.564	0.004
Rv0101.1	31	3b0w_DGX_A_1 PDB CREDO	0.564	0.225	0.564	0.004
Rv0101.1	16	2v0z_C41_O_1327 PDB CREDO	0.645	0.130	0.563	0.004
Rv0101.9	4	1lhu_EST_A_301 PDB CREDO	0.583	0.200	0.563	0.004
Rv0101.9	3	2xkw_P1B_B_1475 PDB CREDO	0.606	0.172	0.563	0.004
Rv0101.1	31	2r5q_1UN_D_900 PDB CREDO	0.579	0.204	0.563	0.004
Rv0101.8	5	3e22_LOC_D_700 PDB CREDO	0.693	0.086	0.563	0.004
Rv0101.9	4	2gqg_1N1_A_501 PDB CREDO	0.603	0.175	0.562	0.004
Rv0101.9	3	3g5d_1N1_A_1 PDB CREDO	0.606	0.171	0.562	0.004
Rv0101.6	7	3pyy_STI_A_3 PDB CREDO	0.578	0.206	0.562	0.004
Rv0101.8	5	1nhz_486_A_800 PDB CREDO	0.789	0.029	0.562	0.004
Rv0101.8	46	1qkt_EST_A_600 PDB CREDO	0.611	0.167	0.561	0.004
Rv0101.1	8	4agd_B49_A_2000 PDB CREDO	0.586	0.197	0.561	0.004
Rv0101.8	5	3e22_LOC_B_700 PDB CREDO	0.691	0.087	0.561	0.004
Rv0101.1	18	1kij_NOV_B_444 PDB CREDO	0.583	0.200	0.561	0.004
Rv0101.1	31	2r5q_1UN_B_900 PDB CREDO	0.578	0.207	0.561	0.004
Rv0101.8	5	1uwj_BAX_B_1723 PDB CREDO	0.612	0.165	0.561	0.004
Rv0101.2	8	1jg3_ADN_B_550 PDB CREDO	0.687	0.091	0.560	0.004
Rv0101.1	46	1hwi_115_A_2 PDB CREDO	0.617	0.159	0.560	0.004
Rv0101.6	7	2hyy_STI_A_600 PDB CREDO	0.576	0.209	0.560	0.004
Rv0101.8	5	3jwq_VIA_D_901 PDB CREDO	0.813	0.020	0.560	0.004
Rv0101.8	10	1xbb_STI_A_1 PDB CREDO	0.588	0.193	0.560	0.004
Rv0101.1	31	1sa1_POD_B_700 PDB CREDO	0.560	0.231	0.560	0.004
Rv0101.1	31	3h52_486_B_1 PDB CREDO	0.577	0.208	0.560	0.004
Rv0101.8	46	2j7x_EST_A_1454 PDB CREDO	0.609	0.169	0.560	0.004
Rv0101.6	12	3nrr_D16_B_520 PDB CREDO	0.640	0.134	0.559	0.004
Rv0101.6	12	1uwh_BAX_B_1723 PDB CREDO	0.635	0.140	0.559	0.004
Rv0101.6	7	2vn1_FK5_A_501 PDB CREDO	0.592	0.189	0.559	0.004
Rv0101.8	46	3sxr_1N1_B_2 PDB CREDO	0.582	0.201	0.559	0.004
Rv0101.6	12	2x9g_LYA_B_1270 PDB CREDO	0.597	0.183	0.558	0.004
Rv0101.1	31	3gws_T3_X_500 PDB CREDO	0.673	0.103	0.558	0.004
Rv0101.9	3	3qlg_1N1_B_601 PDB CREDO	0.603	0.176	0.558	0.004
Rv0101.6	12	1uwh_BAX_A_1723 PDB CREDO	0.633	0.142	0.558	0.004
Rv0101.1	16	1uwj_BAX_B_1723 PDB CREDO	0.626	0.149	0.558	0.004
Rv0101.2	8	3ndv_AIC_D_374 PDB CREDO	0.637	0.137	0.558	0.004
Rv0101.8	46	1mx1_THA_F_6 PDB CREDO	0.605	0.174	0.558	0.004
Rv0101.8	5	1p93_DEX_B_2999 PDB CREDO	0.809	0.021	0.557	0.004
Rv0101.8	10	2nnj_225_A_501 PDB CREDO	0.586	0.196	0.557	0.004
Rv0101.6	7	1iep_STI_A_201 PDB CREDO	0.573	0.213	0.557	0.004
Rv0101.2	8	3q1e_T44_D_328 PDB CREDO	0.557	0.234	0.557	0.004
Rv0101.6	12	3apw_DP0_A_190 PDB CREDO	0.575	0.210	0.557	0.004
Rv0101.6	7	3k5v_STI_B_2 PDB CREDO	0.573	0.213	0.557	0.004
Rv0101.6	7	3pyy_STI_B_4 PDB CREDO	0.573	0.213	0.557	0.004
Rv0101.1	31	3ogp_017_B_200 PDB CREDO	0.590	0.191	0.557	0.004
Rv0101.1	31	3h52_486_A_3 PDB CREDO	0.591	0.190	0.556	0.005
Rv0101.6	7	2hyy_STI_D_600 PDB CREDO	0.572	0.214	0.556	0.005
Rv0101.6	7	3mss_STI_D_1 PDB CREDO	0.572	0.214	0.556	0.005
Rv0101.8	46	1a52_EST_A_1 PDB CREDO	0.605	0.173	0.556	0.005
Rv0101.8	46	1a52_EST_B_2 PDB CREDO	0.605	0.173	0.556	0.005
Rv0101.8	46	3hm1_J3Z_B_1 PDB CREDO	0.605	0.173	0.556	0.005
Rv0101.2	8	1bx4_ADN_A_350 PDB CREDO	0.581	0.203	0.556	0.005
Rv0101.8	2	3bjw_SVR_B_501 PDB CREDO	0.741	0.053	0.556	0.005
Rv0101.6	12	3d91_REM_B_350 PDB CREDO	0.669	0.106	0.556	0.005
Rv0101.1	31	1s9p_DES_D_600 PDB CREDO	0.793	0.028	0.555	0.005
Rv0101.6	12	3d91_REM_A_350 PDB CREDO	0.669	0.107	0.555	0.005
Rv0101.2	8	3g1u_ADN_B_438 PDB CREDO	0.655	0.120	0.555	0.005
Rv0101.8	46	1g50_EST_C_2600 PDB CREDO	0.604	0.174	0.555	0.005
Rv0101.5	1	3ogp_017_A_200 PDB CREDO	0.609	0.169	0.555	0.005
Rv0101.6	7	3mss_STI_A_1 PDB CREDO	0.571	0.215	0.555	0.005
Rv0101.2	1	3oct_1N1_A_663 PDB CREDO	0.555	0.237	0.555	0.005
Rv0101.5	6	3cs9_NIL_C_600 PDB CREDO	0.569	0.217	0.555	0.005
Rv0101.1	11	1hwi_115_B_1 PDB CREDO	0.684	0.094	0.555	0.005
Rv0101.6	7	2hyy_STI_C_600 PDB CREDO	0.571	0.216	0.555	0.005
Rv0101.6	7	3ms9_STI_A_1 PDB CREDO	0.571	0.216	0.555	0.005
Rv0101.6	7	3mss_STI_B_1 PDB CREDO	0.571	0.216	0.555	0.005
Rv0101.8	5	1p93_DEX_A_1999 PDB CREDO	0.805	0.023	0.555	0.005
Rv0101.1	31	2o4n_TPV_A_300 PDB CREDO	0.589	0.193	0.554	0.005
Rv0101.2	8	2itz_IRE_A_2021 PDB CREDO	0.628	0.147	0.554	0.005
Rv0101.1	11	1hwi_115_D_3 PDB CREDO	0.683	0.094	0.554	0.005
Rv0101.1	46	1hwk_117_B_1 PDB CREDO	0.664	0.111	0.554	0.005
Rv0101.8	46	2zva_1N1_A_513 PDB CREDO	0.600	0.179	0.554	0.005
Rv0101.8	46	3sxr_1N1_A_1 PDB CREDO	0.600	0.179	0.554	0.005
Rv0101.5	1	1xzx_T3_X_500 PDB CREDO	0.571	0.215	0.554	0.005
Rv0101.5	1	3uvv_T3_A_501 PDB CREDO	0.571	0.215	0.554	0.005
Rv0101.8	46	1pcg_EST_A_1 PDB CREDO	0.602	0.176	0.554	0.005
Rv0101.1	18	3fuu_ADN_A_0 PDB CREDO	0.554	0.239	0.554	0.005
Rv0101.1	11	1uwj_BAX_A_1723 PDB CREDO	0.553	0.239	0.553	0.005
Rv0101.6	7	3ms9_STI_B_1 PDB CREDO	0.569	0.218	0.553	0.005
Rv0101.6	7	3mss_STI_C_1 PDB CREDO	0.569	0.218	0.553	0.005
Rv0101.5	6	3gp0_NIL_A_1 PDB CREDO	0.553	0.239	0.553	0.005
Rv0101.8	2	3bjw_SVR_F_502 PDB CREDO	0.738	0.055	0.553	0.005
Rv0101.2	8	3ndv_AIC_B_376 PDB CREDO	0.632	0.143	0.553	0.005
Rv0101.6	12	1lhu_EST_A_301 PDB CREDO	0.655	0.119	0.553	0.005
Rv0101.6	12	2gqg_1N1_B_502 PDB CREDO	0.572	0.215	0.553	0.005
Rv0101.9	3	3f4x_KLT_A_300 PDB CREDO	0.574	0.211	0.553	0.005
Rv0101.8	46	3lfa_1N1_A_361 PDB CREDO	0.576	0.209	0.553	0.005
Rv0101.5	6	3cs9_NIL_D_600 PDB CREDO	0.567	0.220	0.553	0.005
Rv0101.1	31	3el9_DR7_A_100 PDB CREDO	0.673	0.103	0.552	0.005
Rv0101.8	2	3bjw_SVR_H_504 PDB CREDO	0.737	0.056	0.552	0.005
Rv0101.8	2	3sm2_478_A_126 PDB CREDO	0.700	0.081	0.552	0.005
Rv0101.8	46	1ere_EST_D_600 PDB CREDO	0.600	0.179	0.552	0.005
Rv0101.6	7	1iep_STI_B_202 PDB CREDO	0.568	0.220	0.552	0.005
Rv0101.5	6	1uwj_BAX_B_1723 PDB CREDO	0.709	0.074	0.552	0.005
Rv0101.6	12	2x9g_LYA_D_1270 PDB CREDO	0.631	0.144	0.552	0.005
Rv0101.6	7	3gvu_STI_A_1001 PDB CREDO	0.567	0.220	0.551	0.005
Rv0101.1	18	1jzs_MRC_A_1301 PDB CREDO	0.572	0.214	0.551	0.005
Rv0101.1	31	3erd_DES_B_800 PDB CREDO	0.814	0.020	0.550	0.005
Rv0101.9	3	3spk_TPV_A_100 PDB CREDO	0.681	0.096	0.550	0.005
Rv0101.8	46	1ere_EST_F_600 PDB CREDO	0.599	0.181	0.550	0.005
Rv0101.8	5	1fm6_BRL_X_504 PDB CREDO	0.700	0.081	0.550	0.005
Rv0101.8	5	3ln1_CEL_A_682 PDB CREDO	0.723	0.064	0.550	0.005
Rv0101.8	5	3ln1_CEL_B_682 PDB CREDO	0.723	0.064	0.550	0.005
Rv0101.5	1	1s9p_DES_A_459 PDB CREDO	0.695	0.085	0.550	0.005
Rv0101.2	8	3g1u_ADN_A_438 PDB CREDO	0.648	0.126	0.550	0.005
Rv0101.6	7	1uwj_BAX_B_1723 PDB CREDO	0.600	0.179	0.550	0.005
Rv0101.1	31	1d4y_TPV_A_501 PDB CREDO	0.584	0.199	0.550	0.005
Rv0101.1	31	3v5w_8PR_A_701 PDB CREDO	0.662	0.113	0.550	0.005
Rv0101.8	46	1s9p_DES_A_459 PDB CREDO	0.746	0.050	0.549	0.005
Rv0101.9	4	1lhv_NOG_A_301 PDB CREDO	0.649	0.125	0.549	0.005
Rv0101.8	46	1ere_EST_C_600 PDB CREDO	0.598	0.182	0.549	0.005
Rv0101.8	46	1tbf_VIA_A_501 PDB CREDO	0.683	0.095	0.549	0.005
Rv0101.2	1	3oht_1N1_B_1000 PDB CREDO	0.569	0.218	0.549	0.005
Rv0101.8	5	3ln1_CEL_C_682 PDB CREDO	0.722	0.065	0.549	0.005
Rv0101.1	31	1s9p_DES_A_459 PDB CREDO	0.784	0.031	0.549	0.005
Rv0101.1	31	2y6o_1N1_A_1892 PDB CREDO	0.641	0.134	0.549	0.005
Rv0101.5	1	2aoh_FRD_C_305 PDB CREDO	0.602	0.176	0.549	0.005
Rv0101.5	1	3heg_BAX_A_1 PDB CREDO	0.602	0.176	0.549	0.005
Rv0101.1	31	3erd_DES_A_600 PDB CREDO	0.812	0.021	0.549	0.005
Rv0101.1	31	3h52_486_D_2 PDB CREDO	0.583	0.200	0.549	0.005
Rv0101.6	12	1etr_MIT_H_1 PDB CREDO	0.548	0.247	0.548	0.005
Rv0101.1	16	1z2b_VLB_C_800 PDB CREDO	0.633	0.142	0.548	0.005
Rv0101.5	6	3cs9_NIL_A_600 PDB CREDO	0.610	0.168	0.548	0.005
Rv0101.5	6	3cs9_NIL_B_600 PDB CREDO	0.593	0.187	0.548	0.005
Rv0101.8	10	1sn0_T44_B_602 PDB CREDO	0.576	0.209	0.547	0.005
Rv0101.6	7	3k5v_STI_A_2 PDB CREDO	0.563	0.227	0.547	0.005
Rv0101.1	31	3ufn_ROC_A_401 PDB CREDO	0.702	0.079	0.547	0.005
Rv0101.6	12	2x9g_LYA_C_1270 PDB CREDO	0.626	0.150	0.547	0.005
Rv0101.5	6	3sm2_478_A_126 PDB CREDO	0.590	0.191	0.547	0.005
Rv0101.9	3	1ict_T44_C_128 PDB CREDO	0.665	0.110	0.546	0.005
Rv0101.8	5	3d90_NOG_A_1001 PDB CREDO	0.767	0.039	0.546	0.005
Rv0101.8	46	3g5d_1N1_B_1 PDB CREDO	0.616	0.161	0.546	0.005
Rv0101.8	46	2ocf_EST_A_596 PDB CREDO	0.594	0.186	0.546	0.005
Rv0101.1	31	1n49_RIT_B_301 PDB CREDO	0.629	0.145	0.546	0.005
Rv0101.1	31	1fm6_BRL_X_504 PDB CREDO	0.636	0.138	0.546	0.005
Rv0101.1	31	1t7j_478_A_200 PDB CREDO	0.579	0.204	0.546	0.005
Rv0101.5	1	1y0x_T44_X_500 PDB CREDO	0.580	0.203	0.545	0.005
Rv0101.8	46	3erd_DES_B_800 PDB CREDO	0.714	0.070	0.545	0.005
Rv0101.6	13	1hwi_115_A_2 PDB CREDO	0.564	0.225	0.545	0.005
Rv0101.8	2	2v0z_C41_O_1327 PDB CREDO	0.746	0.050	0.545	0.005
Rv0101.1	16	2v0z_C41_C_1328 PDB CREDO	0.674	0.102	0.545	0.005
Rv0101.8	46	3g5d_1N1_A_1 PDB CREDO	0.615	0.162	0.545	0.005
Rv0101.8	46	3qlg_1N1_A_601 PDB CREDO	0.615	0.162	0.545	0.005
Rv0101.1	31	2fxd_DR7_A_102 PDB CREDO	0.664	0.111	0.545	0.005
Rv0101.6	12	3oct_1N1_A_663 PDB CREDO	0.624	0.152	0.545	0.005
Rv0101.6	13	1hwi_115_C_4 PDB CREDO	0.584	0.199	0.545	0.005
Rv0101.9	4	1jg2_ADN_A_500 PDB CREDO	0.545	0.251	0.545	0.005
Rv0101.8	5	1uwh_BAX_A_1723 PDB CREDO	0.631	0.144	0.544	0.005
Rv0101.6	15	3b2r_VDN_A_1 PDB CREDO	0.570	0.217	0.544	0.005
Rv0101.8	46	3cs8_BRL_A_503 PDB CREDO	0.590	0.191	0.544	0.005
Rv0101.9	4	2y6o_1N1_A_1892 PDB CREDO	0.643	0.131	0.544	0.005
Rv0101.4	9	2xkw_P1B_A_1478 PDB CREDO	0.789	0.029	0.544	0.005
Rv0101.2	1	1cil_ETS_A_263 PDB CREDO	0.563	0.226	0.544	0.006
Rv0101.9	3	3ads_IMN_B_3 PDB CREDO	0.720	0.067	0.544	0.006
Rv0101.8	5	1lhv_NOG_A_301 PDB CREDO	0.692	0.087	0.544	0.006
Rv0101.8	5	1uwh_BAX_B_1723 PDB CREDO	0.630	0.145	0.544	0.006
Rv0101.1	31	1sa1_POD_D_701 PDB CREDO	0.560	0.230	0.543	0.006
Rv0101.1	31	3bbt_FMM_D_91 PDB CREDO	0.724	0.064	0.543	0.006
Rv0101.9	4	1s9p_DES_A_459 PDB CREDO	0.563	0.227	0.543	0.006
Rv0101.5	1	1ya4_CTX_A_1 PDB CREDO	0.917	0.002	0.543	0.006
Rv0101.1	31	3el0_1UN_A_201 PDB CREDO	0.609	0.168	0.543	0.006
Rv0101.1	11	3ut5_LOC_B_502 PDB CREDO	0.628	0.147	0.542	0.006
Rv0101.5	6	2v0z_C41_O_1327 PDB CREDO	0.542	0.255	0.542	0.006
Rv0101.1	16	3bjw_SVR_E_503 PDB CREDO	0.589	0.193	0.542	0.006
Rv0101.6	15	3pgh_FLP_B_701 PDB CREDO	0.542	0.255	0.542	0.006
Rv0101.9	3	3kw2_ADN_B_300 PDB CREDO	0.609	0.169	0.542	0.006
Rv0101.9	3	3r9c_ECL_A_452 PDB CREDO	0.688	0.090	0.542	0.006
Rv0101.8	46	3qlg_1N1_B_601 PDB CREDO	0.611	0.166	0.542	0.006
Rv0101.8	5	1sa1_POD_B_700 PDB CREDO	0.591	0.190	0.542	0.006
Rv0101.6	12	2fum_MIX_D_3539 PDB CREDO	0.599	0.180	0.542	0.006
Rv0101.5	1	3ogp_017_B_200 PDB CREDO	0.649	0.125	0.542	0.006
Rv0101.6	12	3tkd_CYZ_A_266 PDB CREDO	0.577	0.207	0.542	0.006
Rv0101.8	46	1mrl_DOL_A_300 PDB CREDO	0.565	0.224	0.542	0.006
Rv0101.9	3	3adx_IMN_B_3 PDB CREDO	0.633	0.142	0.542	0.006
Rv0101.8	2	1xkk_FMM_A_91 PDB CREDO	0.722	0.065	0.542	0.006
Rv0101.1	16	1uwh_BAX_B_1723 PDB CREDO	0.645	0.129	0.541	0.006
Rv0101.9	4	2ito_IRE_A_2020 PDB CREDO	0.649	0.125	0.541	0.006
Rv0101.6	7	1opj_STI_B_4 PDB CREDO	0.572	0.214	0.541	0.006
Rv0101.1	16	1uwh_BAX_A_1723 PDB CREDO	0.645	0.130	0.541	0.006
Rv0101.6	12	3ln1_CEL_A_682 PDB CREDO	0.541	0.257	0.541	0.006
Rv0101.1	31	2o4p_TPV_A_300 PDB CREDO	0.557	0.234	0.541	0.006
Rv0101.9	3	1m17_AQ4_A_999 PDB CREDO	0.658	0.117	0.541	0.006
Rv0101.2	1	1fm6_BRL_D_503 PDB CREDO	0.560	0.230	0.541	0.006
Rv0101.1	31	3lzv_017_A_200 PDB CREDO	0.607	0.171	0.541	0.006
Rv0101.5	1	1nhz_486_A_800 PDB CREDO	0.616	0.161	0.541	0.006
Rv0101.2	1	3bbt_FMM_D_91 PDB CREDO	0.560	0.231	0.541	0.006
Rv0101.6	7	3oez_STI_A_601 PDB CREDO	0.556	0.235	0.540	0.006
Rv0101.8	5	3d90_NOG_B_2001 PDB CREDO	0.759	0.043	0.540	0.006
Rv0101.3	6	3uq6_ADN_B_401 PDB CREDO	0.595	0.185	0.540	0.006
Rv0101.5	6	2qxs_RAL_A_600 PDB CREDO	0.585	0.197	0.540	0.006
Rv0101.8	10	3ads_IMN_B_3 PDB CREDO	0.749	0.049	0.540	0.006
Rv0101.2	1	2prg_BRL_A_1 PDB CREDO	0.559	0.232	0.540	0.006
Rv0101.1	31	3spk_TPV_A_100 PDB CREDO	0.694	0.085	0.540	0.006
Rv0101.8	2	3bjw_SVR_E_503 PDB CREDO	0.778	0.034	0.539	0.006
Rv0101.5	6	3nxu_RIT_B_600 PDB CREDO	0.584	0.198	0.539	0.006
Rv0101.8	10	1r9o_FLP_A_501 PDB CREDO	0.654	0.121	0.539	0.006
Rv0101.6	12	3ln1_CEL_C_682 PDB CREDO	0.539	0.260	0.539	0.006
Rv0101.5	1	3gws_T3_X_500 PDB CREDO	0.574	0.211	0.539	0.006
Rv0101.5	1	3h0a_9RA_A_500 PDB CREDO	0.635	0.140	0.539	0.006
Rv0101.1	18	3ti1_B49_A_299 PDB CREDO	0.538	0.260	0.538	0.006
Rv0101.9	4	3kw2_ADN_B_300 PDB CREDO	0.698	0.082	0.538	0.006
Rv0101.6	12	3ln1_CEL_B_682 PDB CREDO	0.538	0.261	0.538	0.006
Rv0101.8	46	3erd_DES_A_600 PDB CREDO	0.705	0.077	0.538	0.006
Rv0101.2	1	3jwq_VIA_D_901 PDB CREDO	0.557	0.234	0.538	0.006
Rv0101.5	1	1bsx_T3_A_1 PDB CREDO	0.574	0.212	0.538	0.006
Rv0101.5	1	1bsx_T3_B_2 PDB CREDO	0.574	0.212	0.538	0.006
Rv0101.6	12	1uwj_BAX_B_1723 PDB CREDO	0.648	0.126	0.538	0.006
Rv0101.2	8	1ict_T44_D_129 PDB CREDO	0.635	0.140	0.538	0.006
Rv0101.2	8	2c49_ADN_A_1301 PDB CREDO	0.660	0.115	0.538	0.006
Rv0101.8	46	1gs4_ZK5_A_1918 PDB CREDO	0.704	0.078	0.538	0.006
Rv0101.1	31	3s56_ROC_A_201 PDB CREDO	0.655	0.120	0.538	0.006
Rv0101.6	12	2aa5_STR_A_301 PDB CREDO	0.555	0.237	0.537	0.006
Rv0101.9	3	3bbt_FMM_D_91 PDB CREDO	0.642	0.132	0.537	0.006
Rv0101.6	12	1z2b_VLB_C_800 PDB CREDO	0.628	0.147	0.537	0.006
Rv0101.8	2	2xkw_P1B_A_1478 PDB CREDO	0.698	0.082	0.537	0.006
Rv0101.6	12	3k54_1N1_A_1 PDB CREDO	0.684	0.094	0.537	0.006
Rv0101.8	46	1m17_AQ4_A_999 PDB CREDO	0.537	0.263	0.537	0.006
Rv0101.6	7	1opj_STI_A_3 PDB CREDO	0.567	0.220	0.537	0.006
Rv0101.2	8	3ri5_IVM_E_349 PDB CREDO	0.633	0.142	0.536	0.006
Rv0101.8	5	3sm2_478_A_126 PDB CREDO	0.682	0.095	0.536	0.006
Rv0101.8	46	2xkw_P1B_B_1475 PDB CREDO	0.702	0.079	0.536	0.006
Rv0101.5	6	1uob_PNN_A_1311 PDB CREDO	0.710	0.074	0.536	0.006
Rv0101.5	6	1y0x_T44_X_500 PDB CREDO	0.731	0.059	0.536	0.006
Rv0101.6	12	2aa6_STR_B_402 PDB CREDO	0.554	0.238	0.536	0.006
Rv0101.1	18	1d4f_ADN_A_601 PDB CREDO	0.558	0.233	0.536	0.006
Rv0101.1	31	1zgy_BRL_A_503 PDB CREDO	0.690	0.089	0.536	0.006
Rv0101.3	6	3uq6_ADN_A_401 PDB CREDO	0.590	0.191	0.536	0.006
Rv0101.5	6	2qxs_RAL_B_600 PDB CREDO	0.581	0.203	0.536	0.006
Rv0101.5	6	3nxu_RIT_A_600 PDB CREDO	0.581	0.203	0.536	0.006
Rv0101.1	31	1sgu_MK1_B_2632 PDB CREDO	0.568	0.219	0.536	0.006
Rv0101.8	46	3kw2_ADN_B_300 PDB CREDO	0.581	0.203	0.536	0.006
Rv0101.9	4	3bbt_FMM_D_91 PDB CREDO	0.554	0.238	0.535	0.006
Rv0101.6	15	3b2r_VDN_B_1 PDB CREDO	0.560	0.230	0.535	0.006
Rv0101.9	3	1sn5_T3_C_601 PDB CREDO	0.679	0.098	0.535	0.006
Rv0101.6	12	2aa6_STR_A_401 PDB CREDO	0.553	0.240	0.535	0.006
Rv0101.1	9	3prs_RIT_A_1001 PDB CREDO	0.735	0.057	0.535	0.006
Rv0101.8	46	1s9p_DES_D_600 PDB CREDO	0.726	0.062	0.535	0.006
Rv0101.8	2	3kk6_CEL_A_701 PDB CREDO	0.714	0.071	0.535	0.006
Rv0101.6	15	3hm1_J3Z_A_2 PDB CREDO	0.535	0.266	0.535	0.006
Rv0101.8	46	3hm1_J3Z_A_2 PDB CREDO	0.665	0.110	0.535	0.006
Rv0101.8	5	1sa1_POD_D_701 PDB CREDO	0.601	0.178	0.535	0.006
Rv0101.6	12	1qkn_RAL_A_600 PDB CREDO	0.535	0.266	0.535	0.006
Rv0101.9	3	2uxo_TAC_B_1211 PDB CREDO	0.624	0.151	0.535	0.006
Rv0101.9	3	3q1e_T44_C_128 PDB CREDO	0.555	0.237	0.535	0.006
Rv0101.1	11	3q70_RIT_A_2001 PDB CREDO	0.601	0.178	0.534	0.006
Rv0101.8	5	3uvv_T3_A_501 PDB CREDO	0.680	0.097	0.534	0.006
Rv0101.2	1	3qt0_486_A_4 PDB CREDO	0.553	0.240	0.534	0.006
Rv0101.6	12	1fm6_BRL_X_504 PDB CREDO	0.552	0.242	0.534	0.006
Rv0101.1	18	3oht_1N1_A_1000 PDB CREDO	0.576	0.209	0.534	0.006
Rv0101.5	6	1z2b_VLB_C_800 PDB CREDO	0.706	0.076	0.534	0.006
Rv0101.8	10	2uxp_CLM_B_1211 PDB CREDO	0.647	0.127	0.534	0.006
Rv0101.5	1	2hw2_RFP_A_1200 PDB CREDO	0.534	0.267	0.534	0.006
Rv0101.1	16	3kk6_CEL_B_1701 PDB CREDO	0.564	0.225	0.534	0.007
Rv0101.5	6	1opj_STI_A_3 PDB CREDO	0.594	0.186	0.533	0.007
Rv0101.6	15	1pbc_BHA_A_396 PDB CREDO	0.558	0.233	0.533	0.007
Rv0101.8	10	1sn0_T44_C_601 PDB CREDO	0.677	0.100	0.533	0.007
Rv0101.8	5	1ya3_STR_B_2001 PDB CREDO	0.802	0.024	0.533	0.007
Rv0101.5	6	3b0w_DGX_A_1 PDB CREDO	0.685	0.093	0.533	0.007
Rv0101.3	6	1lik_ADN_A_699 PDB CREDO	0.533	0.268	0.533	0.007
Rv0101.2	8	3ndv_AIC_C_375 PDB CREDO	0.638	0.137	0.533	0.007
Rv0101.5	1	1mx1_THA_C_3 PDB CREDO	0.673	0.103	0.533	0.007
Rv0101.1	31	3oht_1N1_B_1000 PDB CREDO	0.760	0.042	0.532	0.007
Rv0101.2	1	2fum_MIX_D_3539 PDB CREDO	0.551	0.242	0.532	0.007
Rv0101.2	1	3oht_1N1_A_1000 PDB CREDO	0.615	0.162	0.532	0.007
Rv0101.2	1	4eb6_VLB_C_503 PDB CREDO	0.571	0.215	0.532	0.007
Rv0101.6	13	3ce6_ADN_D_500 PDB CREDO	0.658	0.116	0.532	0.007
Rv0101.1	31	3so9_017_A_100 PDB CREDO	0.565	0.223	0.532	0.007
Rv0101.1	11	1hwi_115_A_2 PDB CREDO	0.722	0.065	0.532	0.007
Rv0101.2	8	3ndv_AIC_A_375 PDB CREDO	0.637	0.138	0.532	0.007
Rv0101.9	3	1z9y_FUN_A_500 PDB CREDO	0.552	0.241	0.532	0.007
Rv0101.5	6	1opj_STI_B_4 PDB CREDO	0.592	0.189	0.532	0.007
Rv0101.5	6	3frq_ERY_A_195 PDB CREDO	0.663	0.112	0.531	0.007
Rv0101.1	31	2xkw_P1B_A_1478 PDB CREDO	0.718	0.068	0.531	0.007
Rv0101.6	12	2aa5_STR_B_302 PDB CREDO	0.549	0.246	0.531	0.007
Rv0101.2	8	3kp5_KAN_A_2001 PDB CREDO	0.577	0.207	0.531	0.007
Rv0101.2	1	1lhu_EST_A_301 PDB CREDO	0.549	0.245	0.531	0.007
Rv0101.1	16	3nxu_RIT_B_600 PDB CREDO	0.561	0.229	0.531	0.007
Rv0101.6	13	3ce6_ADN_C_500 PDB CREDO	0.656	0.118	0.531	0.007
Rv0101.8	10	2eva_ADN_A_498 PDB CREDO	0.558	0.233	0.530	0.007
Rv0101.1	31	3sm2_478_A_126 PDB CREDO	0.736	0.056	0.530	0.007
Rv0101.5	1	1mx1_THA_E_5 PDB CREDO	0.720	0.066	0.530	0.007
Rv0101.9	4	1mx1_THA_C_3 PDB CREDO	0.549	0.246	0.530	0.007
Rv0101.5	1	1fm6_BRL_X_504 PDB CREDO	0.547	0.248	0.530	0.007
Rv0101.1	16	3b0w_DGX_B_1 PDB CREDO	0.530	0.273	0.530	0.007
Rv0101.8	10	1uay_ADN_A_1001 PDB CREDO	0.642	0.132	0.530	0.007
Rv0101.8	5	3ut5_LOC_B_502 PDB CREDO	0.614	0.163	0.530	0.007
Rv0101.1	18	2ity_IRE_A_2020 PDB CREDO	0.551	0.243	0.529	0.007
Rv0101.8	46	3vkx_T3_A_301 PDB CREDO	0.722	0.065	0.529	0.007
Rv0101.6	13	3ce6_ADN_B_500 PDB CREDO	0.654	0.120	0.529	0.007
Rv0101.2	1	4eyb_0WO_B_301 PDB CREDO	0.589	0.193	0.529	0.007
Rv0101.1	31	2z54_AB1_A_200 PDB CREDO	0.544	0.252	0.529	0.007
Rv0101.8	10	2uxp_CLM_A_1211 PDB CREDO	0.641	0.133	0.529	0.007
Rv0101.9	3	2zva_1N1_A_513 PDB CREDO	0.593	0.188	0.528	0.007
Rv0101.6	12	2aax_PDN_A_502 PDB CREDO	0.546	0.250	0.528	0.007
Rv0101.1	46	1hwi_115_C_4 PDB CREDO	0.644	0.130	0.528	0.007
Rv0101.8	10	3ads_IMN_A_1 PDB CREDO	0.556	0.236	0.528	0.007
Rv0101.6	13	3ce6_ADN_A_500 PDB CREDO	0.653	0.122	0.528	0.007
Rv0101.1	31	3vn2_TLS_A_501 PDB CREDO	0.578	0.206	0.528	0.007
Rv0101.9	3	1s9p_DES_A_459 PDB CREDO	0.588	0.193	0.528	0.007
Rv0101.8	5	1xzx_T3_X_500 PDB CREDO	0.671	0.105	0.528	0.007
Rv0101.2	1	2xkw_P1B_B_1475 PDB CREDO	0.566	0.222	0.528	0.007
Rv0101.9	4	3g5d_1N1_B_1 PDB CREDO	0.658	0.117	0.528	0.007
Rv0101.6	15	1eqg_IBP_A_701 PDB CREDO	0.527	0.276	0.527	0.007
Rv0101.8	46	3h52_486_C_4 PDB CREDO	0.690	0.088	0.527	0.007
Rv0101.9	3	3k54_1N1_A_1 PDB CREDO	0.547	0.248	0.527	0.007
Rv0101.8	5	1ya3_STR_A_1001 PDB CREDO	0.792	0.028	0.527	0.007
Rv0101.8	5	2h42_VIA_B_902 PDB CREDO	0.851	0.010	0.527	0.007
Rv0101.1	18	2y7j_B49_B_1294 PDB CREDO	0.571	0.216	0.527	0.007
Rv0101.9	4	3qlg_1N1_B_601 PDB CREDO	0.657	0.118	0.527	0.007
Rv0101.9	3	3cs8_BRL_A_503 PDB CREDO	0.591	0.189	0.527	0.007
Rv0101.3	6	1lii_ADN_A_699 PDB CREDO	0.527	0.277	0.527	0.007
Rv0101.6	12	2aax_PDN_B_503 PDB CREDO	0.544	0.252	0.527	0.007
Rv0101.5	1	2pl0_STI_A_200 PDB CREDO	0.577	0.207	0.526	0.007
Rv0101.8	46	1sn0_T44_C_601 PDB CREDO	0.625	0.150	0.526	0.007
Rv0101.8	46	1sn5_T3_C_601 PDB CREDO	0.549	0.246	0.526	0.007
Rv0101.6	12	3mne_DEX_A_784 PDB CREDO	0.526	0.278	0.526	0.007
Rv0101.1	11	2v0z_C41_O_1327 PDB CREDO	0.619	0.157	0.526	0.007
Rv0101.5	1	1sqn_NDR_A_1001 PDB CREDO	0.664	0.111	0.526	0.007
Rv0101.2	1	3jwq_VIA_B_901 PDB CREDO	0.564	0.224	0.526	0.007
Rv0101.1	16	3tne_RIT_A_401 PDB CREDO	0.666	0.109	0.525	0.007
Rv0101.6	13	3g1u_ADN_C_438 PDB CREDO	0.650	0.125	0.525	0.007
Rv0101.9	4	3spk_TPV_A_100 PDB CREDO	0.563	0.227	0.525	0.007
Rv0101.6	15	3pgh_FLP_C_701 PDB CREDO	0.525	0.280	0.525	0.007
Rv0101.5	1	1gs4_ZK5_A_1918 PDB CREDO	0.688	0.090	0.525	0.007
Rv0101.6	7	1uob_PNN_A_1311 PDB CREDO	0.590	0.191	0.525	0.007
Rv0101.5	1	2aoj_FRD_C_305 PDB CREDO	0.611	0.166	0.525	0.007
Rv0101.9	4	3g5d_1N1_A_1 PDB CREDO	0.655	0.120	0.525	0.007
Rv0101.8	2	1t46_STI_A_3 PDB CREDO	0.738	0.055	0.525	0.007
Rv0101.5	1	2o4n_TPV_A_300 PDB CREDO	0.559	0.232	0.525	0.007
Rv0101.2	1	1zgy_BRL_A_503 PDB CREDO	0.562	0.227	0.525	0.007
Rv0101.1	18	2pgf_ADN_A_501 PDB CREDO	0.566	0.222	0.525	0.007
Rv0101.9	3	3rhw_IVM_A_348 PDB CREDO	0.545	0.251	0.525	0.007
Rv0101.5	1	1sqn_NDR_B_2001 PDB CREDO	0.663	0.112	0.525	0.007
Rv0101.6	7	4asd_BAX_A_1500 PDB CREDO	0.572	0.214	0.525	0.007
Rv0101.8	5	2q1v_PDN_A_248 PDB CREDO	0.789	0.029	0.525	0.007
Rv0101.1	16	3nxu_RIT_A_600 PDB CREDO	0.554	0.238	0.525	0.007
Rv0101.8	5	3nxu_RIT_B_600 PDB CREDO	0.570	0.216	0.525	0.007
Rv0101.5	6	1uwh_BAX_A_1723 PDB CREDO	0.716	0.069	0.525	0.007
Rv0101.5	6	3k5v_STI_A_2 PDB CREDO	0.601	0.178	0.525	0.007
Rv0101.5	6	3mss_STI_A_1 PDB CREDO	0.636	0.139	0.525	0.007
Rv0101.8	5	2h42_VIA_C_903 PDB CREDO	0.846	0.011	0.524	0.008
Rv0101.5	6	1uwh_BAX_B_1723 PDB CREDO	0.715	0.070	0.524	0.008
Rv0101.1	31	2fum_MIX_D_3539 PDB CREDO	0.698	0.082	0.524	0.008
Rv0101.8	46	2cbr_A80_A_201 PDB CREDO	0.638	0.137	0.524	0.008
Rv0101.6	12	1m2z_DEX_A_301 PDB CREDO	0.524	0.281	0.524	0.008
Rv0101.6	7	2hyy_STI_B_600 PDB CREDO	0.589	0.193	0.524	0.008
Rv0101.9	4	1jg3_ADN_A_500 PDB CREDO	0.583	0.200	0.524	0.008
Rv0101.9	4	3tne_RIT_A_401 PDB CREDO	0.639	0.136	0.524	0.008
Rv0101.6	13	3n58_ADN_D_500 PDB CREDO	0.648	0.127	0.524	0.008
Rv0101.9	4	3jwq_VIA_D_901 PDB CREDO	0.542	0.255	0.524	0.008
Rv0101.5	1	2j7y_E3O_A_1454 PDB CREDO	0.766	0.040	0.523	0.008
Rv0101.9	4	3qlg_1N1_A_601 PDB CREDO	0.652	0.122	0.523	0.008
Rv0101.5	6	3ms9_STI_A_1 PDB CREDO	0.634	0.141	0.523	0.008
Rv0101.8	46	1mx1_THA_E_5 PDB CREDO	0.661	0.114	0.523	0.008
Rv0101.6	13	1d4f_ADN_C_603 PDB CREDO	0.580	0.204	0.523	0.008
Rv0101.6	7	3nxu_RIT_A_600 PDB CREDO	0.569	0.219	0.523	0.008
Rv0101.8	5	3nxu_RIT_A_600 PDB CREDO	0.569	0.219	0.523	0.008
Rv0101.1	11	3frq_ERY_A_195 PDB CREDO	0.554	0.238	0.523	0.008
Rv0101.5	1	1d4y_TPV_A_501 PDB CREDO	0.557	0.235	0.523	0.008
Rv0101.6	12	3tkd_CYZ_B_267 PDB CREDO	0.593	0.187	0.523	0.008
Rv0101.6	12	3gn8_DEX_A_247 PDB CREDO	0.523	0.283	0.523	0.008
Rv0101.6	12	3gn8_DEX_B_247 PDB CREDO	0.523	0.283	0.523	0.008
Rv0101.9	3	3ri5_IVM_A_349 PDB CREDO	0.543	0.254	0.523	0.008
Rv0101.9	3	3ria_IVM_E_349 PDB CREDO	0.543	0.254	0.523	0.008
Rv0101.9	3	3sxr_1N1_A_1 PDB CREDO	0.587	0.195	0.523	0.008
Rv0101.2	1	1jg2_ADN_A_500 PDB CREDO	0.523	0.284	0.523	0.008
Rv0101.2	1	1s9p_DES_A_459 PDB CREDO	0.541	0.256	0.523	0.008
Rv0101.2	1	1uwh_BAX_B_1723 PDB CREDO	0.678	0.099	0.523	0.008
Rv0101.5	6	3pyy_STI_A_3 PDB CREDO	0.633	0.142	0.523	0.008
Rv0101.9	4	1kij_NOV_A_400 PDB CREDO	0.541	0.257	0.523	0.008
Rv0101.1	31	1mx1_THA_C_3 PDB CREDO	0.746	0.050	0.522	0.008
Rv0101.1	31	2h79_T3_A_1 PDB CREDO	0.650	0.124	0.522	0.008
Rv0101.8	5	3ut5_LOC_D_502 PDB CREDO	0.644	0.131	0.522	0.008
Rv0101.5	1	2o4p_TPV_A_300 PDB CREDO	0.608	0.170	0.522	0.008
Rv0101.2	1	2x9g_LYA_D_1270 PDB CREDO	0.522	0.284	0.522	0.008
Rv0101.9	4	3oht_1N1_B_1000 PDB CREDO	0.541	0.257	0.522	0.008
Rv0101.6	12	1p93_DEX_D_4999 PDB CREDO	0.522	0.285	0.522	0.008
Rv0101.5	1	1ya4_CTX_B_2 PDB CREDO	0.825	0.017	0.522	0.008
Rv0101.2	1	1uwh_BAX_A_1723 PDB CREDO	0.677	0.100	0.522	0.008
Rv0101.2	8	2ity_IRE_A_2020 PDB CREDO	0.615	0.161	0.522	0.008
Rv0101.8	10	3s20_CER_B_1 PDB CREDO	0.576	0.209	0.521	0.008
Rv0101.6	12	1m2z_DEX_D_401 PDB CREDO	0.521	0.285	0.521	0.008
Rv0101.8	46	1fm6_BRL_D_503 PDB CREDO	0.707	0.075	0.521	0.008
Rv0101.5	6	1iep_STI_B_202 PDB CREDO	0.631	0.143	0.521	0.008
Rv0101.6	15	1eqg_IBP_B_1701 PDB CREDO	0.521	0.286	0.521	0.008
Rv0101.6	15	3mdv_CL6_A_506 PDB CREDO	0.521	0.286	0.521	0.008
Rv0101.6	15	3pgh_FLP_A_701 PDB CREDO	0.521	0.286	0.521	0.008
Rv0101.1	18	3kw2_ADN_B_300 PDB CREDO	0.542	0.255	0.521	0.008
Rv0101.5	1	3cs9_NIL_A_600 PDB CREDO	0.679	0.098	0.521	0.008
Rv0101.2	1	1oq5_CEL_A_701 PDB CREDO	0.559	0.231	0.521	0.008
Rv0101.5	6	3pyy_STI_B_4 PDB CREDO	0.631	0.144	0.521	0.008
Rv0101.8	28	3h9u_ADN_B_438 PDB CREDO	0.728	0.061	0.521	0.008
Rv0101.8	46	2h42_VIA_C_903 PDB CREDO	0.682	0.095	0.521	0.008
Rv0101.9	3	2fum_MIX_D_3539 PDB CREDO	0.623	0.153	0.521	0.008
Rv0101.1	11	3tne_RIT_B_401 PDB CREDO	0.642	0.133	0.521	0.008
Rv0101.1	31	1uob_PNN_A_1311 PDB CREDO	0.536	0.263	0.521	0.008
Rv0101.5	1	2oiq_STI_A_1001 PDB CREDO	0.571	0.216	0.521	0.008
Rv0101.6	7	3nxu_RIT_B_600 PDB CREDO	0.566	0.222	0.521	0.008
Rv0101.5	6	3ms9_STI_B_1 PDB CREDO	0.631	0.144	0.521	0.008
Rv0101.8	46	2uxp_CLM_A_1211 PDB CREDO	0.647	0.127	0.520	0.008
Rv0101.8	46	2uxp_CLM_B_1211 PDB CREDO	0.647	0.127	0.520	0.008
Rv0101.2	8	3ond_ADN_B_507 PDB CREDO	0.543	0.254	0.520	0.008
Rv0101.2	1	1mx1_THA_C_3 PDB CREDO	0.539	0.260	0.520	0.008
Rv0101.2	1	3ads_IMN_A_2 PDB CREDO	0.520	0.287	0.520	0.008
Rv0101.1	31	1d4s_TPV_A_201 PDB CREDO	0.669	0.106	0.520	0.008
Rv0101.8	5	1bsx_T3_A_1 PDB CREDO	0.683	0.094	0.520	0.008
Rv0101.8	5	1bsx_T3_B_2 PDB CREDO	0.683	0.094	0.520	0.008
Rv0101.8	5	3h0a_9RA_A_500 PDB CREDO	0.755	0.045	0.520	0.008
Rv0101.9	3	2cbr_A80_A_201 PDB CREDO	0.520	0.288	0.520	0.008
Rv0101.6	6	1uay_ADN_A_1001 PDB CREDO	0.594	0.186	0.520	0.008
Rv0101.5	6	2hyy_STI_C_600 PDB CREDO	0.630	0.145	0.520	0.008
Rv0101.5	6	3mss_STI_B_1 PDB CREDO	0.630	0.145	0.520	0.008
Rv0101.1	31	2b7z_MK1_B_200 PDB CREDO	0.551	0.243	0.520	0.008
Rv0101.9	4	3sxr_1N1_A_1 PDB CREDO	0.674	0.102	0.520	0.008
Rv0101.6	7	1uwh_BAX_A_1723 PDB CREDO	0.602	0.177	0.520	0.008
Rv0101.8	5	3ln1_CEL_D_682 PDB CREDO	0.755	0.045	0.520	0.008
Rv0101.5	6	2hyy_STI_D_600 PDB CREDO	0.629	0.146	0.519	0.008
Rv0101.1	31	2h77_T3_A_1 PDB CREDO	0.668	0.107	0.519	0.008
Rv0101.8	10	2w9g_TOP_A_1159 PDB CREDO	0.608	0.169	0.519	0.008
Rv0101.9	3	3rhw_IVM_D_348 PDB CREDO	0.539	0.259	0.519	0.008
Rv0101.5	6	1iep_STI_A_201 PDB CREDO	0.629	0.146	0.519	0.008
Rv0101.5	6	3mss_STI_C_1 PDB CREDO	0.629	0.146	0.519	0.008
Rv0101.6	7	1uwh_BAX_B_1723 PDB CREDO	0.601	0.177	0.519	0.008
Rv0101.2	1	3ln1_CEL_D_682 PDB CREDO	0.537	0.262	0.519	0.008
Rv0101.2	8	2xrl_DXT_A_1211 PDB CREDO	0.519	0.289	0.519	0.008
Rv0101.8	46	2j7y_E3O_A_1454 PDB CREDO	0.608	0.170	0.519	0.008
Rv0101.5	6	2hyy_STI_A_600 PDB CREDO	0.629	0.146	0.519	0.008
Rv0101.5	6	3k5v_STI_B_2 PDB CREDO	0.629	0.146	0.519	0.008
Rv0101.8	46	2ayl_FLP_B_2701 PDB CREDO	0.519	0.290	0.519	0.008
Rv0101.9	3	3ria_IVM_C_350 PDB CREDO	0.538	0.260	0.519	0.008
Rv0101.9	4	2ity_IRE_A_2020 PDB CREDO	0.672	0.104	0.518	0.008
Rv0101.5	1	3el0_1UN_A_201 PDB CREDO	0.657	0.117	0.518	0.008
Rv0101.2	1	3tkd_CYZ_A_266 PDB CREDO	0.632	0.143	0.518	0.008
Rv0101.8	5	3jwq_VIA_B_901 PDB CREDO	0.836	0.013	0.518	0.008
Rv0101.1	16	1t46_STI_A_3 PDB CREDO	0.578	0.207	0.518	0.008
Rv0101.5	6	3gvu_STI_A_1001 PDB CREDO	0.628	0.147	0.518	0.008
Rv0101.5	1	1ya4_CTX_C_3 PDB CREDO	0.819	0.018	0.518	0.008
Rv0101.8	46	1pcg_EST_B_2 PDB CREDO	0.644	0.131	0.518	0.008
Rv0101.9	3	3rhw_IVM_B_349 PDB CREDO	0.538	0.261	0.518	0.008
Rv0101.5	6	1hwk_117_B_1 PDB CREDO	0.627	0.148	0.518	0.008
Rv0101.5	6	3mss_STI_D_1 PDB CREDO	0.627	0.148	0.517	0.008
Rv0101.5	1	3mnp_DEX_A_784 PDB CREDO	0.534	0.267	0.517	0.008
Rv0101.1	16	3bjw_SVR_B_501 PDB CREDO	0.608	0.170	0.517	0.008
Rv0101.9	3	3lfa_1N1_A_361 PDB CREDO	0.656	0.119	0.517	0.008
Rv0101.9	3	3rhw_IVM_B_348 PDB CREDO	0.537	0.262	0.517	0.008
Rv0101.9	3	3ria_IVM_A_348 PDB CREDO	0.537	0.262	0.517	0.008
Rv0101.8	46	1r9o_FLP_A_501 PDB CREDO	0.643	0.132	0.517	0.008
Rv0101.5	1	2oax_SNL_F_6001 PDB CREDO	0.567	0.221	0.517	0.008
Rv0101.6	12	3vn2_TLS_A_501 PDB CREDO	0.568	0.219	0.517	0.008
Rv0101.1	11	3ut5_LOC_D_502 PDB CREDO	0.637	0.138	0.517	0.008
Rv0101.8	5	1uob_PNN_A_1311 PDB CREDO	0.581	0.203	0.517	0.008
Rv0101.8	10	3s20_CER_A_1 PDB CREDO	0.517	0.293	0.517	0.008
Rv0101.6	12	1p93_DEX_C_3999 PDB CREDO	0.517	0.293	0.517	0.008
Rv0101.8	46	3h0a_9RA_A_500 PDB CREDO	0.752	0.047	0.517	0.008
Rv0101.9	4	1ya3_STR_A_1001 PDB CREDO	0.517	0.293	0.517	0.008
Rv0101.9	4	2itz_IRE_A_2021 PDB CREDO	0.697	0.083	0.517	0.008
Rv0101.2	8	1jg3_ADN_A_500 PDB CREDO	0.710	0.074	0.516	0.008
Rv0101.9	3	3ri5_IVM_D_349 PDB CREDO	0.536	0.264	0.516	0.008
Rv0101.9	3	3rif_IVM_E_402 PDB CREDO	0.536	0.264	0.516	0.008
Rv0101.5	1	3mno_DEX_A_784 PDB CREDO	0.533	0.269	0.516	0.009
Rv0101.1	11	3tne_RIT_A_401 PDB CREDO	0.636	0.139	0.516	0.009
Rv0101.5	1	1p93_DEX_C_3999 PDB CREDO	0.550	0.244	0.516	0.009
Rv0101.6	15	1uay_ADN_A_1001 PDB CREDO	0.516	0.294	0.516	0.009
Rv0101.6	15	2x7h_PFN_A_1372 PDB CREDO	0.540	0.258	0.516	0.009
Rv0101.1	18	3k54_1N1_A_1 PDB CREDO	0.578	0.207	0.516	0.009
Rv0101.5	1	2oax_SNL_E_5001 PDB CREDO	0.565	0.223	0.516	0.009
Rv0101.2	1	2x9g_LYA_C_1270 PDB CREDO	0.515	0.295	0.515	0.009
Rv0101.8	46	1eqh_FLP_A_701 PDB CREDO	0.561	0.229	0.515	0.009
Rv0101.2	8	3ads_IMN_B_3 PDB CREDO	0.515	0.295	0.515	0.009
Rv0101.1	16	3bjw_SVR_H_504 PDB CREDO	0.605	0.173	0.515	0.009
Rv0101.8	5	1a28_STR_A_1 PDB CREDO	0.802	0.024	0.515	0.009
Rv0101.6	12	1kij_NOV_A_400 PDB CREDO	0.569	0.218	0.515	0.009
Rv0101.6	12	3h0a_9RA_A_500 PDB CREDO	0.569	0.218	0.515	0.009
Rv0101.6	12	4a97_ZPC_J_1318 PDB CREDO	0.632	0.142	0.515	0.009
Rv0101.9	3	3rhw_IVM_D_349 PDB CREDO	0.535	0.266	0.515	0.009
Rv0101.9	3	3ri5_IVM_B_349 PDB CREDO	0.535	0.266	0.515	0.009
Rv0101.2	1	3k54_1N1_A_1 PDB CREDO	0.573	0.213	0.515	0.009
Rv0101.2	1	3nrr_D16_B_520 PDB CREDO	0.515	0.295	0.515	0.009
Rv0101.5	6	3oez_STI_A_601 PDB CREDO	0.624	0.152	0.515	0.009
Rv0101.9	4	1uwh_BAX_B_1723 PDB CREDO	0.668	0.108	0.515	0.009
Rv0101.8	46	1gwr_EST_A_600 PDB CREDO	0.640	0.135	0.514	0.009
Rv0101.8	46	1qku_EST_C_600 PDB CREDO	0.640	0.135	0.514	0.009
Rv0101.8	46	2prg_BRL_A_1 PDB CREDO	0.698	0.082	0.514	0.009
Rv0101.5	1	1p93_DEX_D_4999 PDB CREDO	0.548	0.246	0.514	0.009
Rv0101.2	1	1hwi_115_C_4 PDB CREDO	0.514	0.296	0.514	0.009
Rv0101.9	4	4eyb_0WO_A_303 PDB CREDO	0.533	0.269	0.514	0.009
Rv0101.6	12	3d90_NOG_A_1001 PDB CREDO	0.549	0.245	0.514	0.009
Rv0101.6	12	3ln1_CEL_D_682 PDB CREDO	0.568	0.219	0.514	0.009
Rv0101.1	16	3bjw_SVR_F_502 PDB CREDO	0.604	0.175	0.514	0.009
Rv0101.2	8	2ito_IRE_A_2020 PDB CREDO	0.655	0.120	0.514	0.009
Rv0101.2	8	3g1u_ADN_D_438 PDB CREDO	0.655	0.120	0.514	0.009
Rv0101.5	1	3ufn_ROC_A_401 PDB CREDO	0.746	0.050	0.514	0.009
Rv0101.9	3	3ria_IVM_E_348 PDB CREDO	0.533	0.268	0.514	0.009
Rv0101.8	46	1cqe_FLP_A_1650 PDB CREDO	0.559	0.232	0.514	0.009
Rv0101.8	46	1cqe_FLP_B_2650 PDB CREDO	0.559	0.232	0.514	0.009
Rv0101.8	5	3gws_T3_X_500 PDB CREDO	0.675	0.101	0.513	0.009
Rv0101.8	5	2xkw_P1B_A_1478 PDB CREDO	0.637	0.138	0.513	0.009
Rv0101.9	4	3tne_RIT_B_401 PDB CREDO	0.626	0.149	0.513	0.009
Rv0101.8	2	3prs_RIT_A_1001 PDB CREDO	0.619	0.157	0.513	0.009
Rv0101.5	1	2oax_SNL_D_4001 PDB CREDO	0.563	0.226	0.513	0.009
Rv0101.9	4	1uwh_BAX_A_1723 PDB CREDO	0.666	0.109	0.513	0.009
Rv0101.8	28	3h9u_ADN_D_438 PDB CREDO	0.717	0.068	0.513	0.009
Rv0101.1	31	1mx1_THA_E_5 PDB CREDO	0.787	0.030	0.513	0.009
Rv0101.9	4	2gqg_1N1_B_502 PDB CREDO	0.568	0.219	0.513	0.009
Rv0101.9	4	1ya3_STR_B_2001 PDB CREDO	0.513	0.298	0.513	0.009
Rv0101.5	6	3uvv_T3_A_501 PDB CREDO	0.769	0.038	0.513	0.009
Rv0101.5	6	4asd_BAX_A_1500 PDB CREDO	0.659	0.116	0.513	0.009
Rv0101.6	12	3d90_NOG_B_2001 PDB CREDO	0.548	0.247	0.513	0.009
Rv0101.2	8	3ond_ADN_A_506 PDB CREDO	0.605	0.173	0.513	0.009
Rv0101.8	46	3r9c_ECL_A_452 PDB CREDO	0.535	0.266	0.513	0.009
Rv0101.6	15	1r9o_FLP_A_501 PDB CREDO	0.513	0.299	0.513	0.009
Rv0101.6	15	3f8w_ADN_A_300 PDB CREDO	0.513	0.299	0.513	0.009
Rv0101.6	7	3cs9_NIL_A_600 PDB CREDO	0.542	0.255	0.513	0.009
Rv0101.2	8	2riw_T44_A_1395 PDB CREDO	0.535	0.266	0.512	0.009
Rv0101.2	1	3tne_RIT_A_401 PDB CREDO	0.625	0.150	0.512	0.009
Rv0101.5	1	3mne_DEX_A_784 PDB CREDO	0.546	0.249	0.512	0.009
Rv0101.5	6	2v0z_C41_C_1328 PDB CREDO	0.553	0.239	0.512	0.009
Rv0101.6	7	3cs9_NIL_C_600 PDB CREDO	0.588	0.194	0.512	0.009
Rv0101.1	11	3d91_REM_A_350 PDB CREDO	0.559	0.232	0.512	0.009
Rv0101.6	12	1uwj_BAX_A_1723 PDB CREDO	0.673	0.103	0.512	0.009
Rv0101.2	8	4e3a_ADN_B_500 PDB CREDO	0.678	0.099	0.512	0.009
Rv0101.1	18	2itz_IRE_A_2021 PDB CREDO	0.554	0.238	0.512	0.009
Rv0101.8	46	3jwq_VIA_D_901 PDB CREDO	0.745	0.051	0.512	0.009
Rv0101.6	13	1hwi_115_B_1 PDB CREDO	0.583	0.200	0.512	0.009
Rv0101.8	46	1eqh_FLP_B_1701 PDB CREDO	0.557	0.234	0.512	0.009
Rv0101.8	46	1gwr_EST_B_600 PDB CREDO	0.636	0.138	0.512	0.009
Rv0101.8	46	1qku_EST_A_600 PDB CREDO	0.636	0.138	0.512	0.009
Rv0101.8	46	1qku_EST_B_600 PDB CREDO	0.636	0.138	0.512	0.009
Rv0101.6	12	1ya3_STR_B_2001 PDB CREDO	0.586	0.197	0.512	0.009
Rv0101.6	12	2zbv_ADN_A_501 PDB CREDO	0.652	0.123	0.512	0.009
Rv0101.6	13	3hku_TOR_A_300 PDB CREDO	0.610	0.167	0.512	0.009
Rv0101.1	31	3d91_REM_A_350 PDB CREDO	0.512	0.300	0.512	0.009
Rv0101.2	8	2trt_TAC_A_222 PDB CREDO	0.580	0.204	0.512	0.009
Rv0101.2	1	2cbr_A80_A_201 PDB CREDO	0.591	0.190	0.512	0.009
Rv0101.2	1	2h42_VIA_B_902 PDB CREDO	0.549	0.245	0.512	0.009
Rv0101.9	4	2q1v_PDN_A_248 PDB CREDO	0.512	0.300	0.512	0.009
Rv0101.6	15	3miy_B49_B_2 PDB CREDO	0.512	0.300	0.512	0.009
Rv0101.1	18	1d4f_ADN_D_604 PDB CREDO	0.552	0.241	0.512	0.009
Rv0101.6	6	1sn5_T3_C_601 PDB CREDO	0.534	0.267	0.512	0.009
Rv0101.6	13	1hwi_115_D_3 PDB CREDO	0.582	0.201	0.511	0.009
Rv0101.5	1	1n49_RIT_D_401 PDB CREDO	0.613	0.164	0.511	0.009
Rv0101.6	12	3kw2_ADN_A_300 PDB CREDO	0.676	0.101	0.511	0.009
Rv0101.8	28	3h9u_ADN_A_439 PDB CREDO	0.714	0.070	0.511	0.009
Rv0101.8	28	3h9u_ADN_C_438 PDB CREDO	0.714	0.070	0.511	0.009
Rv0101.1	31	1hsh_MK1_A_401 PDB CREDO	0.623	0.153	0.511	0.009
Rv0101.5	6	1xzx_T3_X_500 PDB CREDO	0.766	0.039	0.511	0.009
Rv0101.5	1	2oax_SNL_A_1001 PDB CREDO	0.561	0.229	0.511	0.009
Rv0101.1	11	3tkd_CYZ_B_267 PDB CREDO	0.592	0.189	0.511	0.009
Rv0101.1	31	1z2b_VLB_C_800 PDB CREDO	0.526	0.278	0.511	0.009
Rv0101.1	46	2a69_RPT_M_8002 PDB CREDO	0.582	0.201	0.511	0.009
Rv0101.6	12	2gqg_1N1_A_501 PDB CREDO	0.627	0.148	0.511	0.009
Rv0101.2	1	2uxo_TAC_B_1211 PDB CREDO	0.689	0.089	0.511	0.009
Rv0101.6	15	2bxf_DZP_B_2001 PDB CREDO	0.511	0.302	0.511	0.009
Rv0101.5	1	3lzv_017_A_200 PDB CREDO	0.647	0.127	0.511	0.009
Rv0101.1	18	2uxo_TAC_B_1211 PDB CREDO	0.553	0.240	0.511	0.009
Rv0101.1	31	3d91_REM_B_350 PDB CREDO	0.511	0.302	0.511	0.009
Rv0101.5	1	3vhu_SNL_A_1001 PDB CREDO	0.510	0.302	0.510	0.009
Rv0101.2	1	1hwi_115_A_2 PDB CREDO	0.565	0.223	0.510	0.009
Rv0101.1	18	1kij_NOV_A_400 PDB CREDO	0.658	0.116	0.510	0.009
Rv0101.8	46	3pgh_FLP_D_701 PDB CREDO	0.555	0.237	0.510	0.009
Rv0101.2	1	3spk_TPV_A_100 PDB CREDO	0.546	0.249	0.510	0.009
Rv0101.6	15	1jlb_NVP_A_999 PDB CREDO	0.534	0.267	0.510	0.009
Rv0101.8	10	3vkx_T3_A_301 PDB CREDO	0.563	0.226	0.510	0.009
Rv0101.1	31	2qhc_AB1_B_9001 PDB CREDO	0.556	0.235	0.510	0.009
Rv0101.8	5	3h52_486_C_4 PDB CREDO	0.823	0.017	0.510	0.009
Rv0101.6	12	1zgy_BRL_A_503 PDB CREDO	0.545	0.252	0.510	0.009
Rv0101.6	12	3ads_IMN_A_2 PDB CREDO	0.583	0.200	0.510	0.009
Rv0101.6	12	3k2h_LYA_B_514 PDB CREDO	0.604	0.174	0.510	0.009
Rv0101.2	8	2pkm_ADN_A_501 PDB CREDO	0.557	0.235	0.510	0.009
Rv0101.6	6	1sn0_T44_C_601 PDB CREDO	0.557	0.235	0.510	0.009
Rv0101.8	46	3bbt_FMM_D_91 PDB CREDO	0.741	0.053	0.510	0.009
Rv0101.1	18	1d4f_ADN_B_602 PDB CREDO	0.550	0.244	0.509	0.009
Rv0101.8	10	3uq6_ADN_B_401 PDB CREDO	0.590	0.191	0.509	0.009
Rv0101.1	16	3b0w_DGX_A_1 PDB CREDO	0.572	0.215	0.509	0.009
Rv0101.6	12	2fum_MIX_A_539 PDB CREDO	0.625	0.150	0.509	0.009
Rv0101.5	6	3d91_REM_A_350 PDB CREDO	0.654	0.120	0.509	0.009
Rv0101.5	6	3gws_T3_X_500 PDB CREDO	0.788	0.029	0.509	0.009
Rv0101.6	15	3axz_ADN_A_401 PDB CREDO	0.557	0.234	0.509	0.009
Rv0101.6	15	4dt8_ADN_A_401 PDB CREDO	0.533	0.269	0.509	0.009
Rv0101.9	3	2fum_MIX_A_539 PDB CREDO	0.548	0.247	0.509	0.009
Rv0101.9	3	3rif_IVM_A_403 PDB CREDO	0.548	0.247	0.509	0.009
Rv0101.1	11	1z2b_VLB_C_800 PDB CREDO	0.572	0.214	0.509	0.009
Rv0101.5	1	2oax_SNL_C_3001 PDB CREDO	0.509	0.304	0.509	0.010
Rv0101.5	6	1bsx_T3_A_1 PDB CREDO	0.787	0.030	0.509	0.010
Rv0101.5	6	1bsx_T3_B_2 PDB CREDO	0.787	0.030	0.509	0.010
Rv0101.6	15	1fj8_CER_D_500 PDB CREDO	0.607	0.171	0.509	0.010
Rv0101.2	1	3k2h_LYA_B_514 PDB CREDO	0.527	0.277	0.509	0.010
Rv0101.9	3	3sxr_1N1_B_2 PDB CREDO	0.594	0.186	0.509	0.010
Rv0101.2	8	3rhw_IVM_A_348 PDB CREDO	0.648	0.126	0.509	0.010
Rv0101.1	31	3ekq_ROC_A_100 PDB CREDO	0.603	0.175	0.509	0.010
Rv0101.8	46	2fum_MIX_B_1539 PDB CREDO	0.530	0.273	0.509	0.010
Rv0101.3	6	3mdv_CL6_B_506 PDB CREDO	0.509	0.305	0.509	0.010
Rv0101.1	16	3kk6_CEL_A_701 PDB CREDO	0.597	0.182	0.508	0.010
Rv0101.2	1	3h0a_9RA_A_500 PDB CREDO	0.526	0.278	0.508	0.010
Rv0101.6	15	3s7s_EXM_A_601 PDB CREDO	0.533	0.269	0.508	0.010
Rv0101.5	1	2x2n_X2N_B_1479 PDB CREDO	0.508	0.305	0.508	0.010
Rv0101.1	18	4dta_ADN_A_401 PDB CREDO	0.681	0.096	0.508	0.010
Rv0101.1	11	3d91_REM_B_350 PDB CREDO	0.554	0.238	0.508	0.010
Rv0101.1	16	3frq_ERY_A_195 PDB CREDO	0.554	0.239	0.508	0.010
Rv0101.8	46	1sqn_NDR_A_1001 PDB CREDO	0.690	0.089	0.508	0.010
Rv0101.8	46	3oht_1N1_A_1000 PDB CREDO	0.618	0.158	0.508	0.010
Rv0101.9	3	1d4f_ADN_D_604 PDB CREDO	0.508	0.306	0.508	0.010
Rv0101.8	12	3gcs_BAX_A_401 PDB CREDO	0.586	0.196	0.508	0.010
Rv0101.2	8	3ri5_IVM_A_349 PDB CREDO	0.648	0.127	0.508	0.010
Rv0101.5	1	2aa6_STR_B_402 PDB CREDO	0.560	0.231	0.508	0.010
Rv0101.5	1	2ab2_SNL_B_503 PDB CREDO	0.508	0.306	0.508	0.010
Rv0101.5	1	2oax_SNL_B_2001 PDB CREDO	0.508	0.306	0.508	0.010
Rv0101.5	1	3d90_NOG_B_2001 PDB CREDO	0.579	0.206	0.508	0.010
Rv0101.6	12	2y6o_1N1_A_1892 PDB CREDO	0.525	0.281	0.508	0.010
Rv0101.6	12	3ua1_08Y_A_600 PDB CREDO	0.525	0.281	0.508	0.010
Rv0101.1	31	2aoh_FRD_C_305 PDB CREDO	0.523	0.283	0.508	0.010
Rv0101.1	8	1ki3_PE2_B_2 PDB CREDO	0.530	0.272	0.508	0.010
Rv0101.1	8	3u40_ADN_F_251 PDB CREDO	0.530	0.272	0.508	0.010
Rv0101.6	6	1pg2_ADN_A_552 PDB CREDO	0.608	0.170	0.508	0.010
Rv0101.6	6	4dt8_ADN_A_401 PDB CREDO	0.555	0.238	0.508	0.010
Rv0101.8	5	1q23_FUA_F_704 PDB CREDO	0.646	0.128	0.508	0.010
Rv0101.1	16	3pww_ROC_A_1001 PDB CREDO	0.566	0.222	0.508	0.010
Rv0101.8	7	1v8b_ADN_D_3502 PDB CREDO	0.529	0.274	0.508	0.010
Rv0101.8	46	1ere_EST_B_600 PDB CREDO	0.631	0.144	0.508	0.010
Rv0101.8	46	1g50_EST_B_1600 PDB CREDO	0.631	0.144	0.508	0.010
Rv0101.2	1	1d4f_ADN_C_603 PDB CREDO	0.526	0.279	0.508	0.010
Rv0101.9	4	3sxr_1N1_B_2 PDB CREDO	0.685	0.093	0.508	0.010
Rv0101.5	6	3bjw_SVR_C_505 PDB CREDO	0.535	0.265	0.508	0.010
Rv0101.8	46	2prg_BRL_B_2 PDB CREDO	0.689	0.090	0.508	0.010
Rv0101.8	5	2h79_T3_A_1 PDB CREDO	0.689	0.089	0.507	0.010
Rv0101.5	1	2aax_PDN_B_503 PDB CREDO	0.559	0.232	0.507	0.010
Rv0101.5	1	2ab2_SNL_A_502 PDB CREDO	0.507	0.307	0.507	0.010
Rv0101.5	1	3d90_NOG_A_1001 PDB CREDO	0.578	0.206	0.507	0.010
Rv0101.5	1	3gn8_DEX_A_247 PDB CREDO	0.541	0.257	0.507	0.010
Rv0101.1	16	1lhv_NOG_A_301 PDB CREDO	0.664	0.111	0.507	0.010
Rv0101.6	15	1tbf_VIA_A_501 PDB CREDO	0.507	0.307	0.507	0.010
Rv0101.1	31	1c6y_MK1_B_524 PDB CREDO	0.618	0.158	0.507	0.010
Rv0101.9	3	1sn0_T44_C_601 PDB CREDO	0.733	0.058	0.507	0.010
Rv0101.8	46	3jwq_VIA_B_901 PDB CREDO	0.664	0.111	0.507	0.010
Rv0101.6	15	1udt_VIA_A_1000 PDB CREDO	0.531	0.272	0.507	0.010
Rv0101.2	1	1uwj_BAX_B_1723 PDB CREDO	0.699	0.082	0.507	0.010
Rv0101.9	4	3nrr_D16_B_520 PDB CREDO	0.507	0.308	0.507	0.010
Rv0101.5	1	2aa6_STR_A_401 PDB CREDO	0.558	0.232	0.507	0.010
Rv0101.5	1	2x2n_X2N_A_1480 PDB CREDO	0.507	0.308	0.507	0.010
Rv0101.5	1	3gn8_DEX_B_247 PDB CREDO	0.540	0.257	0.507	0.010
Rv0101.6	12	2ab2_SNL_A_502 PDB CREDO	0.540	0.257	0.507	0.010
Rv0101.5	1	3cs9_NIL_B_600 PDB CREDO	0.679	0.098	0.507	0.010
Rv0101.6	6	1ie4_T44_A_128 PDB CREDO	0.551	0.242	0.507	0.010
Rv0101.8	7	1v8b_ADN_B_1502 PDB CREDO	0.528	0.275	0.507	0.010
Rv0101.1	16	2nni_MTK_A_501 PDB CREDO	0.552	0.241	0.507	0.010
Rv0101.9	3	2a69_RPT_C_8001 PDB CREDO	0.507	0.308	0.507	0.010
Rv0101.6	12	1p93_DEX_B_2999 PDB CREDO	0.560	0.230	0.507	0.010
Rv0101.6	12	2q1v_PDN_A_248 PDB CREDO	0.580	0.204	0.507	0.010
Rv0101.2	8	3rhw_IVM_B_349 PDB CREDO	0.646	0.129	0.507	0.010
Rv0101.5	6	3bjw_SVR_G_506 PDB CREDO	0.520	0.288	0.506	0.010
Rv0101.5	6	3d91_REM_B_350 PDB CREDO	0.651	0.124	0.506	0.010
Rv0101.5	1	1m2z_DEX_A_301 PDB CREDO	0.540	0.258	0.506	0.010
Rv0101.5	1	3bbt_FMM_D_91 PDB CREDO	0.597	0.183	0.506	0.010
Rv0101.6	12	2ab2_SNL_B_503 PDB CREDO	0.540	0.258	0.506	0.010
Rv0101.6	12	1a28_STR_B_2 PDB CREDO	0.523	0.283	0.506	0.010
Rv0101.9	4	3jwq_VIA_B_901 PDB CREDO	0.544	0.253	0.506	0.010
Rv0101.6	15	3f8w_ADN_B_301 PDB CREDO	0.506	0.309	0.506	0.010
Rv0101.6	15	3nrr_D16_A_520 PDB CREDO	0.554	0.239	0.506	0.010
Rv0101.1	31	3h0a_9RA_A_500 PDB CREDO	0.674	0.102	0.506	0.010
Rv0101.6	12	3jwq_VIA_D_901 PDB CREDO	0.559	0.231	0.506	0.010
Rv0101.6	6	2x1l_ADN_C_601 PDB CREDO	0.553	0.240	0.506	0.010
Rv0101.5	1	1m2z_DEX_D_401 PDB CREDO	0.539	0.259	0.506	0.010
Rv0101.6	12	2oax_SNL_B_2001 PDB CREDO	0.539	0.259	0.506	0.010
Rv0101.8	46	1ere_EST_A_600 PDB CREDO	0.629	0.146	0.506	0.010
Rv0101.8	46	1uho_VDN_A_1000 PDB CREDO	0.527	0.276	0.506	0.010
Rv0101.2	8	3rhw_IVM_B_348 PDB CREDO	0.645	0.130	0.506	0.010
Rv0101.2	8	3ria_IVM_A_348 PDB CREDO	0.645	0.130	0.506	0.010
Rv0101.9	4	3bbt_FMM_B_91 PDB CREDO	0.607	0.171	0.506	0.010
Rv0101.6	13	1ynn_RFP_C_1120 PDB CREDO	0.581	0.202	0.506	0.010
Rv0101.8	46	1zgy_BRL_A_503 PDB CREDO	0.761	0.042	0.506	0.010
Rv0101.8	5	1t46_STI_A_3 PDB CREDO	0.580	0.204	0.506	0.010
Rv0101.1	31	1hsh_MK1_C_402 PDB CREDO	0.616	0.160	0.506	0.010
Rv0101.6	12	2prg_BRL_B_2 PDB CREDO	0.599	0.180	0.506	0.010
Rv0101.1	18	2fum_MIX_D_3539 PDB CREDO	0.652	0.122	0.506	0.010
Rv0101.5	1	2aax_PDN_A_502 PDB CREDO	0.557	0.235	0.505	0.010
Rv0101.8	5	2f38_15M_A_325 PDB CREDO	0.604	0.174	0.505	0.010
Rv0101.6	7	3cs9_NIL_B_600 PDB CREDO	0.549	0.245	0.505	0.010
Rv0101.1	18	1ki3_PE2_A_1 PDB CREDO	0.525	0.279	0.505	0.010
Rv0101.9	3	2xn7_T44_A_1355 PDB CREDO	0.590	0.191	0.505	0.010
Rv0101.9	3	3ri5_IVM_C_350 PDB CREDO	0.544	0.253	0.505	0.010
Rv0101.2	1	3bbt_FMM_B_91 PDB CREDO	0.606	0.172	0.505	0.010
Rv0101.2	1	3f4x_KLT_A_300 PDB CREDO	0.606	0.172	0.505	0.010
Rv0101.5	6	2hw2_RFP_A_1200 PDB CREDO	0.733	0.058	0.505	0.010
Rv0101.1	18	2ito_IRE_A_2020 PDB CREDO	0.525	0.280	0.505	0.010
Rv0101.2	8	3ri5_IVM_B_349 PDB CREDO	0.644	0.131	0.505	0.010
Rv0101.6	12	1cil_ETS_A_263 PDB CREDO	0.558	0.233	0.505	0.010
Rv0101.6	12	1nhz_486_A_800 PDB CREDO	0.540	0.259	0.505	0.010
Rv0101.1	31	1skx_RFP_A_1 PDB CREDO	0.599	0.180	0.505	0.010
Rv0101.8	5	1zgy_BRL_A_503 PDB CREDO	0.708	0.074	0.505	0.010
Rv0101.8	2	1uwj_BAX_A_1723 PDB CREDO	0.813	0.020	0.505	0.010
Rv0101.9	3	3erd_DES_B_800 PDB CREDO	0.543	0.254	0.505	0.010
Rv0101.9	3	3ria_IVM_C_349 PDB CREDO	0.543	0.254	0.505	0.010
Rv0101.9	3	3rif_IVM_A_402 PDB CREDO	0.543	0.254	0.505	0.010
Rv0101.9	3	3rif_IVM_D_402 PDB CREDO	0.543	0.254	0.505	0.010
Rv0101.9	3	1d4f_ADN_B_602 PDB CREDO	0.505	0.311	0.505	0.010
Rv0101.1	18	1ie4_T44_A_128 PDB CREDO	0.569	0.218	0.505	0.010
Rv0101.6	13	3znc_BZ1_A_500 PDB CREDO	0.648	0.126	0.505	0.010
Rv0101.8	46	3nt1_NPS_A_5 PDB CREDO	0.526	0.279	0.504	0.010
Rv0101.8	46	3nt1_NPS_B_4 PDB CREDO	0.526	0.279	0.504	0.010
Rv0101.5	1	2q1v_PDN_A_248 PDB CREDO	0.615	0.161	0.504	0.010
Rv0101.2	8	3rhw_IVM_D_348 PDB CREDO	0.643	0.131	0.504	0.010
Rv0101.2	8	3ria_IVM_E_349 PDB CREDO	0.643	0.131	0.504	0.010
Rv0101.2	8	3rif_IVM_E_402 PDB CREDO	0.643	0.131	0.504	0.010
Rv0101.6	7	1t46_STI_A_3 PDB CREDO	0.578	0.206	0.504	0.010
Rv0101.1	8	2ki5_AC2_B_2 PDB CREDO	0.527	0.278	0.504	0.010
Rv0101.5	6	3vn2_TLS_A_501 PDB CREDO	0.709	0.074	0.504	0.010
Rv0101.5	1	1zgy_BRL_A_503 PDB CREDO	0.574	0.211	0.504	0.010
Rv0101.1	31	1a28_STR_B_2 PDB CREDO	0.588	0.194	0.504	0.010
Rv0101.1	31	3qt0_486_A_4 PDB CREDO	0.671	0.105	0.504	0.010
Rv0101.2	1	1jg3_ADN_A_500 PDB CREDO	0.561	0.229	0.504	0.010
Rv0101.9	3	3rif_IVM_B_403 PDB CREDO	0.542	0.255	0.504	0.010
Rv0101.6	7	3cs9_NIL_D_600 PDB CREDO	0.578	0.206	0.504	0.010
Rv0101.8	10	3fl9_TOP_B_200 PDB CREDO	0.530	0.272	0.504	0.010
Rv0101.9	3	2xn6_T44_A_1370 PDB CREDO	0.589	0.193	0.504	0.010
Rv0101.5	1	2r5q_1UN_B_900 PDB CREDO	0.586	0.196	0.504	0.010
Rv0101.8	5	1q23_FUA_H_709 PDB CREDO	0.641	0.133	0.504	0.010
Rv0101.2	1	1kij_NOV_A_400 PDB CREDO	0.521	0.285	0.504	0.010
Rv0101.2	1	2h42_VIA_A_901 PDB CREDO	0.521	0.285	0.504	0.010
Rv0101.2	8	3rhw_IVM_D_349 PDB CREDO	0.642	0.132	0.504	0.010
Rv0101.6	15	1fj8_CER_A_500 PDB CREDO	0.600	0.178	0.504	0.010
Rv0101.6	15	1fj8_CER_C_500 PDB CREDO	0.600	0.178	0.504	0.010
Rv0101.1	8	1ki3_PE2_A_1 PDB CREDO	0.594	0.186	0.504	0.010
Rv0101.1	31	1mui_AB1_B_100 PDB CREDO	0.535	0.266	0.504	0.010
Rv0101.1	31	1sdv_MK1_B_902 PDB CREDO	0.630	0.145	0.504	0.010
Rv0101.5	1	3ln1_CEL_B_682 PDB CREDO	0.537	0.263	0.503	0.010
Rv0101.5	1	3ln1_CEL_C_682 PDB CREDO	0.537	0.263	0.503	0.010
Rv0101.8	5	2x2n_X2N_B_1479 PDB CREDO	0.621	0.155	0.503	0.010
Rv0101.1	31	3oy4_017_B_200 PDB CREDO	0.518	0.290	0.503	0.010
Rv0101.6	12	1uob_PNN_A_1311 PDB CREDO	0.589	0.193	0.503	0.010
Rv0101.9	3	1hwi_115_C_4 PDB CREDO	0.581	0.202	0.503	0.010
Rv0101.9	4	3fuu_ADN_A_0 PDB CREDO	0.627	0.148	0.503	0.010
Rv0101.6	15	4cox_IMN_D_701 PDB CREDO	0.503	0.313	0.503	0.010
Rv0101.9	3	2xn5_FUN_A_1356 PDB CREDO	0.588	0.194	0.503	0.010
Rv0101.5	6	3frq_ERY_B_195 PDB CREDO	0.730	0.060	0.503	0.010
Rv0101.8	12	3gp0_NIL_A_1 PDB CREDO	0.560	0.230	0.503	0.010
Rv0101.1	31	2oax_SNL_F_6001 PDB CREDO	0.518	0.290	0.503	0.010
Rv0101.1	31	3ebz_017_B_201 PDB CREDO	0.518	0.291	0.503	0.010
Rv0101.6	12	1fm6_BRL_D_503 PDB CREDO	0.596	0.184	0.503	0.010
Rv0101.2	8	3ri5_IVM_D_349 PDB CREDO	0.641	0.133	0.503	0.010
Rv0101.9	3	1hwi_115_A_2 PDB CREDO	0.643	0.132	0.503	0.010
Rv0101.9	4	2x9g_LYA_C_1270 PDB CREDO	0.503	0.314	0.503	0.010
Rv0101.1	31	2oax_SNL_E_5001 PDB CREDO	0.518	0.291	0.503	0.010
Rv0101.8	10	2w03_ADN_A_1588 PDB CREDO	0.558	0.233	0.503	0.010
Rv0101.8	46	1ie4_T44_A_128 PDB CREDO	0.503	0.314	0.503	0.010
Rv0101.8	46	3lp1_NVP_A_701 PDB CREDO	0.524	0.282	0.503	0.010
Rv0101.5	1	3ln1_CEL_A_682 PDB CREDO	0.536	0.264	0.502	0.011
Rv0101.6	12	3vhu_SNL_A_1001 PDB CREDO	0.536	0.264	0.502	0.011
Rv0101.2	1	2h77_T3_A_1 PDB CREDO	0.538	0.261	0.502	0.011
Rv0101.6	7	2oiq_STI_A_1001 PDB CREDO	0.564	0.224	0.502	0.011
Rv0101.1	31	2oax_SNL_D_4001 PDB CREDO	0.517	0.292	0.502	0.011
Rv0101.9	3	3oct_1N1_A_663 PDB CREDO	0.580	0.204	0.502	0.011
Rv0101.9	4	1a28_STR_A_1 PDB CREDO	0.520	0.288	0.502	0.011
Rv0101.6	15	2bxf_DZP_A_2001 PDB CREDO	0.502	0.315	0.502	0.011
Rv0101.6	15	3miy_B49_A_1 PDB CREDO	0.502	0.315	0.502	0.011
Rv0101.6	13	1hwk_117_D_3 PDB CREDO	0.608	0.169	0.502	0.011
Rv0101.2	8	3sxr_1N1_B_2 PDB CREDO	0.569	0.218	0.502	0.011
Rv0101.8	7	1d4f_ADN_A_601 PDB CREDO	0.544	0.252	0.502	0.011
Rv0101.1	31	2bpx_MK1_B_902 PDB CREDO	0.563	0.226	0.502	0.011
Rv0101.1	18	2fum_MIX_A_539 PDB CREDO	0.583	0.200	0.502	0.011
Rv0101.6	12	1ya3_STR_A_1001 PDB CREDO	0.574	0.211	0.502	0.011
Rv0101.8	5	2x2n_X2N_A_1480 PDB CREDO	0.619	0.157	0.502	0.011
Rv0101.6	15	1fj8_CER_B_500 PDB CREDO	0.598	0.181	0.502	0.011
Rv0101.8	46	1ere_EST_E_600 PDB CREDO	0.624	0.152	0.502	0.011
Rv0101.8	46	3lp0_NVP_A_701 PDB CREDO	0.523	0.283	0.502	0.011
Rv0101.6	13	2a69_RPT_M_8002 PDB CREDO	0.502	0.316	0.502	0.011
Rv0101.1	18	1ie4_T44_B_328 PDB CREDO	0.502	0.316	0.502	0.011
Rv0101.5	1	2h79_T3_A_1 PDB CREDO	0.552	0.241	0.501	0.011
Rv0101.5	6	1tco_FK5_C_509 PDB CREDO	0.528	0.276	0.501	0.011
Rv0101.9	4	2h42_VIA_A_901 PDB CREDO	0.519	0.289	0.501	0.011
Rv0101.2	8	3ria_IVM_E_348 PDB CREDO	0.639	0.135	0.501	0.011
Rv0101.1	11	1uwj_BAX_B_1723 PDB CREDO	0.547	0.248	0.501	0.011
Rv0101.8	5	3aod_RFP_C_2002 PDB CREDO	0.839	0.013	0.501	0.011
Rv0101.1	8	3s68_TCW_A_227 PDB CREDO	0.501	0.316	0.501	0.011
Rv0101.2	8	3mg0_BO2_H_1400 PDB CREDO	0.573	0.213	0.501	0.011
Rv0101.6	15	3pgh_FLP_D_701 PDB CREDO	0.573	0.213	0.501	0.011
Rv0101.1	31	2rkg_AB1_B_501 PDB CREDO	0.532	0.269	0.501	0.011
Rv0101.1	31	3e22_LOC_B_700 PDB CREDO	0.566	0.221	0.501	0.011
Rv0101.5	1	3gcs_BAX_A_401 PDB CREDO	0.566	0.221	0.501	0.011
Rv0101.1	31	2aoj_FRD_C_305 PDB CREDO	0.516	0.293	0.501	0.011
Rv0101.2	8	2o7o_DXT_A_222 PDB CREDO	0.568	0.219	0.501	0.011
Rv0101.8	7	3g0e_B49_A_9000 PDB CREDO	0.522	0.284	0.501	0.011
Rv0101.6	7	3b0w_DGX_B_1 PDB CREDO	0.515	0.294	0.501	0.011
Rv0101.5	6	1fm6_BRL_X_504 PDB CREDO	0.751	0.047	0.501	0.011
Rv0101.1	11	1sa1_POD_B_700 PDB CREDO	0.547	0.249	0.501	0.011
Rv0101.5	1	2r5q_1UN_D_900 PDB CREDO	0.583	0.200	0.501	0.011
Rv0101.5	6	3bjw_SVR_B_512 PDB CREDO	0.514	0.297	0.501	0.011
Rv0101.1	8	3ti1_B49_A_299 PDB CREDO	0.614	0.162	0.501	0.011
Rv0101.2	8	1ie4_T44_B_328 PDB CREDO	0.614	0.162	0.501	0.011
Rv0101.6	13	2a68_RBT_C_8001 PDB CREDO	0.575	0.210	0.501	0.011
Rv0101.6	13	3sv9_SV6_A_1 PDB CREDO	0.643	0.131	0.501	0.011
Rv0101.5	1	2h77_T3_A_1 PDB CREDO	0.570	0.217	0.500	0.011
Rv0101.1	31	2oax_SNL_A_1001 PDB CREDO	0.516	0.294	0.500	0.011
Rv0101.2	8	1v8b_ADN_C_2502 PDB CREDO	0.590	0.191	0.500	0.011
Rv0101.1	16	3tne_RIT_B_401 PDB CREDO	0.634	0.140	0.500	0.011
Rv0101.5	6	2hyy_STI_B_600 PDB CREDO	0.662	0.113	0.500	0.011
Rv0101.8	46	1ya3_STR_C_3001 PDB CREDO	0.632	0.143	0.500	0.011
Rv0101.2	1	3o1c_ADN_A_127 PDB CREDO	0.557	0.234	0.500	0.011
Rv0101.9	4	3k2h_LYA_B_514 PDB CREDO	0.518	0.290	0.500	0.011
Rv0101.6	7	3d91_REM_A_350 PDB CREDO	0.546	0.250	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions