Rv3110

Tuberculist information
Gene namemoaB1
Protein functionProbable pterin-4-alpha-carbinolamine dehydratase MoaB1 (PHS) (4-alpha- hydroxy-tetrahydropterin dehydratase) (pterin-4-a-carbinolamine dehydratase) (phenylalanine hydroxylase-stimulating protein) (PHS) (pterin carbinolamine dehydratase) (PCD)
Functional category(tuberculist)intermediary metabolism and respiration
Gene location(kb)3478.78
Molecular mass(da)14558.3
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 131
	  		  	1    MTVSTPEQHEQRASHDASEGKHNVCQGRLAALADAAVSEKLGALPGWQLLDMRLSRAFQC   60
			  	61   TNFDQSIDFMNRVASIANDINHHPDIAVLDKRSVRVTAWTRKLGYLTDIDFDLAASVEAM  120
			  	121  YATEFADRPAR

Known structures in the PDB
No Known structures
1 14 27 40 53 66 79 92 105 118 131 Range: 27 to 122  |  Coverage: 72% Pterin_4a Range: 28 to 123  |  Coverage: 72% 1 Range: 28 to 126  |  Coverage: 74% 1
Number of amino acids : 131
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
Pterin_4aPF0132927-122
Mtb Structural Proteome models
Model Number1
Model nameRv3110
Template1RU0    APDBCREDO
Template coverage4_102
Template Identity(%)29.2
Model coverage(%)72.5
Normalized DOPE score-0.65

Structure Models from Chopin
Model Number1
Profiled.74.1.1 - 3.30.1360.20
Click for model details
zscore23.62
Residue begin28
Residue end126
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv3110Gene nameConfidence Score
Rv3111moaC10.913
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions