Tuberculist information
Gene namecanA
Protein functionBeta-carbonic anhydrase
Functional category(tuberculist)intermediary metabolism and respiration
Gene location(kb)1437.32
Molecular mass(da)18156.7
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 163
	  		  	1    VTVTDDYLANNVDYASGFKGPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAG   60
			  	61   CVVTDDVIRSLAISQRLLGTREIILLHHTDCGMLTFTDDDFKRAIQDETGIRPTWSPESY  120
			  	121  PDAVEDVRQSLRRIEVNPFVTKHTSLRGFVFDVATGKLNEVTP
			  			

Known structures in the PDB
PDB ID1YLK
Total residue count688
Number of chains4
MethodX-RAY
Resolution2
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
Pro_CAPF0048430-158
Mtb Structural Proteome models
Model Number1
Model nameRv1284_1ylk_A
Template1YLK    APDBCREDO
Template coverage1_163
Template Identity(%)100.0
Model coverage(%)98.8
Normalized DOPE score-1.324

Model Number2
Model nameRv1284
Template1YLK    APDBCREDO
Template coverage2_163
Template Identity(%)100.0
Model coverage(%)98.2
Normalized DOPE score-0.893

Structure Models from Chopin
Model Number1
Profilec.53.2.1 - 3.40.1050.10
Click for model details
zscore23.33
Residue begin1
Residue end163
Binding pockets
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1284Gene nameConfidence Score
Rv3588ccanB0.925
Potential ligand/drug binding sites
Protein ModelPocket NumberDrug Binding Site PMIN ScorePvalue PMINPMAX ScorePvalue PMAX
Rv1284_1ylk_A83nxu_RIT_A_600PDBCREDO0.5740.2110.5300.007
Rv1284_1ylk_A83nxu_RIT_B_600PDBCREDO0.5710.2160.5270.007
Rv1284_1ylk_A83cs9_NIL_D_600PDBCREDO0.5320.2690.5180.008
Rv1284_1ylk_A83k5v_STI_A_2PDBCREDO0.5890.1920.5150.009
Rv1284_1ylk_A83cs9_NIL_C_600PDBCREDO0.5200.2880.5060.010
Rv1284_1ylk_A81opj_STI_A_3PDBCREDO0.5620.2270.5050.010
Rv1284_1ylk_A11phg_MYT_A_422PDBCREDO0.5320.2700.5030.010
Rv1284_1ylk_A81opj_STI_B_4PDBCREDO0.5570.2340.5000.011
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
  View results in TIBLE page
NameAffinityAssay descriptionDOI
CHEMBL118Ki = 10.35 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL1337519Ki = 69.3 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL14060Ki = 64 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL1446150Ki = 4.8 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1614844Ki = 67.1 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1615215Ki = 509 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1615280Ki = 5610 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1615281Ki = 6.4 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643289Ki = 440 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643290Ki = 4330 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643291Ki = 7.5 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643292Ki = 6.8 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643293Ki = 65.7 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643294Ki = 473 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643295Ki = 470 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643296Ki = 5690 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643297Ki = 4760 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643298Ki = 35.2 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643299Ki = 6500 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643300Ki = 50.2 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643301Ki = 534 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643302Ki = 560 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643303Ki = 5590 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643304Ki = 49.1 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643305Ki = 728 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643306Ki = 315 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL1643307Ki = 486 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL16909Ki = 7.2 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL17Ki = 0.872 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL1772Ki = 10.8 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL18Ki = 1.03 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL19Ki = 0.781 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL19Ki = 0.781 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL20Ki = 480 nMInhibition of recombinant Mycobacterium tuberculosis Rv1284 carbonic anhydrase after 15 mins by stopped flow CO2 hydration assay at pH 7.5http://www.ncbi.nlm.nih.gov/pubmed/21570835
CHEMBL20Ki = 0.481 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL20Ki = 481 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL20Ki = 480 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 at pH 8.3 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21757360
CHEMBL20Ki = 250 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL20Ki = 0.481 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL20Ki = 0.48 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL21Ki = 9.84 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL21Ki = 9.84 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL21Ki = 9230 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL218490Ki = 0.744 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL218490Ki = 0.744 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL220491Ki = 0.839 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL220491Ki = 0.839 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL220492Ki = 0.612 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL220492Ki = 0.61 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL228274Ki = 0.82 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL237251Ki = 0.126 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL25600Ki = 356 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL26Ki = 2.3 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL265674Ki = 11.54 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL266026Ki = 0.612 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL266026Ki = 612 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL266240Ki = 1.72 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL268177Ki = 7.71 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL268439Ki = 0.905 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL274704Ki = 6.78 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL277836Ki = 6.86 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL310671Ki = 7.96 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL316779Ki = 5 nMInhibition of Mycobacterium tuberculosis recombinant beta-carbonic anhydrase Rv1284 preincubated for 15 mins by stopped-flow CO2 hydrase assayhttp://www.ncbi.nlm.nih.gov/pubmed/21145236
CHEMBL328560Ki = 5.16 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL360356Ki = 7.48 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL375927Ki = 0.85 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL379206Ki = 9.27 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL414Ki = 8.21 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL418Ki = 8.1 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL419Ki = 8690 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL419Ki = 8.69 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL447310Ki = 0.85 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL447310Fold change = 75 NoneInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assay relative to phenolhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL451332Ki = 7.93 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL463133Ki = 0.84 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL463134Ki = 0.71 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL466234Ki = 10.5 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL466832Ki = 9 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL467258Ki = 113 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL467897Ki = 43.4 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL467898Ki = 30.8 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL468094Ki = 11.3 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL468294Ki = 7.6 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL468945Ki = 110 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL468946Ki = 5.1 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL469126Ki = 8.5 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL501294Ki = 9.7 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL511239Ki = 12.3 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL512633Ki = 7.5 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL513835Ki = 25.1 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL513854Ki = 3.2 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL517222Ki = 0.8 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL521690Ki = 8.6 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL53566Ki = 0.85 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL53566Fold change = 75 NoneInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assay relative to phenolhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL569350Ki = 63 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL569351Ki = 8.67 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL569804Ki = 8.71 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL570257Ki = 7.51 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL570615Ki = 7 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL571371Ki = 7.69 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL571385Ki = 8.97 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL571598Ki = 7.86 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL574Ki = 4.92 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL576908Ki = 7.54 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL578932Ki = 12.3 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL588491Ki = 11 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL589354Ki = 12.2 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL589604Ki = 1.78 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL589606Ki = 1.27 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL590883Ki = 0.99 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL591736Ki = 0.91 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL592010Ki = 10.3 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL592140Ki = 10.5 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL592384Ki = 10.5 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL601464Ki = 0.8 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL603189Ki = 11.8 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL605189Ki = 11.6 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL606453Ki = 1.16 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL6633Ki = 0.75 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6633Ki = 109 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL6705Ki = 9.23 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6724Ki = 6500 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL6724Ki = 0.186 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6753Ki = 12.65 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6784Ki = 5.51 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6853Ki = 8.74 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL6919Ki = 9.56 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL7087Ki = 9560 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL7087Ki = 9.56 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL7092Ki = 7.52 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL7146Ki = 853 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19651511
CHEMBL7146Ki = 0.853 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL73962Ki = 0.81 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL750Ki = 28.68 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL750Ki = 286.8 uMInhibition of Mycobacterium tuberculosis recombinant Rv1284 beta-carbonic anhydrase after 15 mins by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/21332115
CHEMBL77517Ki = 0.097 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
CHEMBL77517Ki = 31 nMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase Rv1284 by by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19438226
CHEMBL865Ki = 12.97 uMInhibition of Mycobacterium tuberculosis recombinant carbonic anhydrase 1 encoded by Rv1284 by stopped flow CO2 hydration assayhttp://www.ncbi.nlm.nih.gov/pubmed/19338333
Off-target activity - ligand based from TIBLE
  View results in TIBLE page
Predicted off-targetMethodSummaryFull results
Cellular retinoic acid-binding protein 2 1CBSPharmMapper7 hydroph + 2 HB + 1 pos/neg + 0 aromLink
cAMP-dependent protein kinase catalytic subunit alpha 1XH5PharmMapper6 hydroph + 2 HB + 1 pos/neg + 0 aromLink
Cell division protein kinase 2 2G9XPharmMapper1 hydroph + 6 HB + 1 pos/neg + 0 aromLink
Transthyretin 1RLBPharmMapper9 hydroph + 1 HB + 0 pos/neg + 0 aromLink
Histo-blood group ABO system transferase 1WT2PharmMapper3 hydroph + 7 HB + 0 pos/neg + 0 aromLink
JAK2 expression  PASSPa = 0.904 & SM = CHEMBL228274Link
Aldehyde oxidase  PASSPa = 0.893 & SM = CHEMBL18Link
Aldehyde oxidase  PASSPa = 0.734 & SM = CHEMBL228274Link
Cyclin-dependent kinase 1 SEAE_value = 8.6e-18 & MaxTC = 0.58Link
dihydropteroate synthase [-] SEAE_value = 1.82e-12 & MaxTC = 0.63Link
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
Chemical NameConfidence scoreMolecular Weight
zincPubChem0.9865.409
N-(3-chloro-7-indolyl)-1,4-benzenedisulfonamidePubChem0.955385.846
3-bromosulfanilamidePubChem0.929251.101
thiocyanatePubChem0.91359.0903
acetazolamidePubChem0.907222.245
CHEBI:579662PubChem0.9315.347
CHEBI:578723PubChem0.9624.922
CHEBI:579359PubChem0.9552.96
CHEBI:579360PubChem0.9552.96
CHEBI:579442PubChem0.9613.865
CHEBI:579443PubChem0.9613.865
CHEBI:579508PubChem0.9548.996
CHEBI:578722PubChem0.9564.995
CHEBI:579284PubChem0.9534.969
CHEBI:579285PubChem0.9552.96
CHEBI:579361PubChem0.9569.414
CHEBI:579440PubChem0.9569.414
CHEBI:579441PubChem0.9613.865
CHEBI:579506PubChem0.9548.996
ethoxzolamidePubChem0.846258.317
NSC-135784PubChem0.841301.753
CHEBI:579507PubChem0.84548.996
CHEBI:579362PubChem0.837569.414
sulfonamidePubChem0.833172.205
NeoprontosilPubChem0.825544.535
AABSSNPubChem0.825544.535
methazolamidePubChem0.823237.28
dichlorphenamidePubChem0.819305.159
benzolamidePubChem0.808320.369
topiramatePubChem0.801339.362
brinzolamidePubChem0.794383.507
dorzolamidePubChem0.785324.44
carbon dioxidePubChem0.73544.0095