Rv1224

Tuberculist information
Gene nametatB
Protein functionProbable protein TatB
Functional category(tuberculist)cell wall and cell processes
Gene location(kb)1367.46
Molecular mass(da)14082
External sites TB Database TubercuList WebTB
Protein sequence
Number of amino acids : 131
	  		  	1    VFANIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFD   60
			  	61   DLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRPTPKKPDAAGSAGPDATEQIG  120
			  	121  AGPIPFDSDAT

Known structures in the PDB
No Known structures
1 14 27 40 53 66 79 92 105 118 131 Range: 5 to 71  |  Coverage: 50% MttA_Hcf106
Number of amino acids : 131
Domains assigned based on sequence. Mtb Structural proteome models CHOPIN models
Profile-based domain assignment
Structural/Functional domain familyPfam acc.no./SCOP IDDomain Region
MttA_Hcf106PF024165-71
Mtb Structural Proteome models
Structure models not available for this query
Structure Models from Chopin
CHOPIN models not available for this query
Binding pockets
Structure models not available for this query
STRING
Cytoscape Web will replace the contents of this div with protein-protein interaction network.
Protein interacting with Rv1224Gene nameConfidence Score
Rv2093ctatC0.957
Potential ligand/drug binding sites
No binding sites identified
Similarity to known drug target from sensitive sequence analysis
No drug targets
List of small molecules tested from TIBLE
Data not available
Off-target activity - ligand based from TIBLE
Data not available
Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.
Data not available
STITCH interactions  
No high confidence interactions