SInCRe - Rv1084

Tuberculist information

Gene name	Rv1084
Protein function	Conserved protein
Functional category(tuberculist)	conserved hypotheticals
Gene location(kb)	1207.64
Molecular mass(da)	71050.3
External sites	TB Database TubercuList WebTB

Protein sequence

Number of amino acids : 673

	  		  	1    MSPANPSGTNTLALATSPYLRQHADNPVHWQQWTPQALAEAAARAVPILLSVGYAACHWC   60
			  	61   HVMAHESFDDDEVAAAMNAGFVCIKVDREERPDIDAVYMNATVALTGQGGWPMTCFLTPN  120
			  	121  GRPFFCGTYYPKAAFLQLLSAISETWRERRAEVEQASDHIAAELRSMASGLPGGGPEVAP  180
			  	181  ELCDDAVAGVLREQDTAHGGFGGAPKFPPSALLEALMRHYERTRSPAALEAVARTGNAMA  240
			  	241  RGGIYDQLGGGFARYSVDGAWVVPHFEKMLYDNALLLRAYAHWARRTGDPLARRVAAQTA  300
			  	301  RFLLDELGSKAPADMFTSSLDADADGREGSTYVWTPVQLTEVLGGDDGRWAAEVFGVTEA  360
			  	361  GTFEHGTSVLQLPADPDDAARLDRVRAALLVARLARAQPARDDKVVTSWNGLAITALAEA  420
			  	421  SVALDDPALAHAARRCATRLLDLHVVDGRLRRASLGGVVGDSAAILEDHAMLATGLLALY  480
			  	481  QLTSEGAWLTAATGLLDTAVAHFGDPQRPGRWFDTADDAERLMLRPSDPLDGATPSGASS  540
			  	541  IAEALLTAGHVVDGARAERYWQLAADTLRAHAVLLARAPRSAGHWLAVAEAVVRGPLQIA  600
			  	601  VACDLPRSSLLADARRLAPGGAIVVGGAAGSSALLVGRDRVAGADAAYVCRGRVCDLPVT  660
			  	661  SAAELATALGVPG

Known structures in the PDB

No Known structures

Number of amino acids : 673

Domains assigned based on sequence.

Mtb Structural proteome models

CHOPIN models

Profile-based domain assignment

Structural/Functional domain family	Pfam acc.no./SCOP ID	Domain Region
Thioredox_DsbH	PF03190	9-165
GlcNAc_2-epim	PF07221	219-518

Mtb Structural Proteome models

Model Number	1
Model name	Rv1084.1
Template	1EP7 APDB CREDO
Template coverage	13_112
Template Identity(%)	14.0
Model coverage(%)	16.5
Normalized DOPE score	-0.041

Model Number	2
Model name	Rv1084.2
Template	2CVK APDB CREDO
Template coverage	9_105
Template Identity(%)	16.5
Model coverage(%)	15.9
Normalized DOPE score	0.136

Model Number	3
Model name	Rv1084
Template	2FV1 APDB CREDO
Template coverage	2_346
Template Identity(%)	15.7
Model coverage(%)	56.2
Normalized DOPE score	0.529

Model Number	4
Model name	Rv1084.4
Template	2AFA APDB CREDO
Template coverage	7_408
Template Identity(%)	9.8
Model coverage(%)	61.8
Normalized DOPE score	1.045

Structure Models from Chopin

Model Number	1
Profile	c.47.1.24 Click for model details
zscore	6.91
Residue begin	9
Residue end	160

Binding pockets

STRING

Cytoscape Web will replace the contents of this div with protein-protein interaction network.

Protein interacting with Rv1084	Gene name	Confidence Score
Rv1083	Rv1083	0.984
Rv1082	mca	0.977

Potential ligand/drug binding sites

Protein Model	Pocket Number	Drug Binding Site	PMIN Score	Pvalue PMIN	PMAX Score	Pvalue PMAX
Rv1084.2	1	3ri5_IVM_E_349 PDB CREDO	0.690	0.088	0.690	0.000
Rv1084.2	1	3ri5_IVM_B_349 PDB CREDO	0.737	0.055	0.682	0.000
Rv1084.2	1	3rif_IVM_E_402 PDB CREDO	0.734	0.057	0.679	0.000
Rv1084.2	1	3ri5_IVM_D_349 PDB CREDO	0.732	0.059	0.677	0.000
Rv1084.2	1	3rhw_IVM_B_349 PDB CREDO	0.730	0.060	0.676	0.000
Rv1084.2	1	3rhw_IVM_D_348 PDB CREDO	0.729	0.060	0.675	0.000
Rv1084.2	1	3ri5_IVM_A_349 PDB CREDO	0.729	0.060	0.675	0.000
Rv1084.2	1	3rhw_IVM_B_348 PDB CREDO	0.729	0.061	0.674	0.000
Rv1084.2	1	3ria_IVM_A_348 PDB CREDO	0.729	0.061	0.674	0.000
Rv1084.2	1	3ria_IVM_C_350 PDB CREDO	0.728	0.061	0.673	0.000
Rv1084.2	1	3ria_IVM_E_349 PDB CREDO	0.727	0.062	0.673	0.000
Rv1084.2	1	3rhw_IVM_D_349 PDB CREDO	0.725	0.063	0.671	0.000
Rv1084.2	1	3ria_IVM_E_348 PDB CREDO	0.722	0.065	0.668	0.001
Rv1084.2	1	3rhw_IVM_A_348 PDB CREDO	0.722	0.065	0.668	0.001
Rv1084.2	1	1ict_T44_D_129 PDB CREDO	0.635	0.139	0.635	0.001
Rv1084.2	1	3sxr_1N1_A_1 PDB CREDO	0.633	0.142	0.633	0.001
Rv1084.2	1	3rif_IVM_A_402 PDB CREDO	0.764	0.040	0.632	0.001
Rv1084.2	1	3rif_IVM_D_402 PDB CREDO	0.764	0.040	0.632	0.001
Rv1084.2	1	3rif_IVM_B_403 PDB CREDO	0.762	0.042	0.631	0.001
Rv1084.2	1	3ri5_IVM_C_350 PDB CREDO	0.761	0.042	0.630	0.001
Rv1084.2	1	3ria_IVM_C_349 PDB CREDO	0.757	0.044	0.627	0.001
Rv1084.2	1	1ya3_STR_C_3001 PDB CREDO	0.729	0.061	0.626	0.001
Rv1084.2	1	3rif_IVM_A_403 PDB CREDO	0.749	0.048	0.620	0.001
Rv1084.2	1	3adx_IMN_B_3 PDB CREDO	0.642	0.132	0.617	0.002
Rv1084.2	1	3sxr_1N1_B_2 PDB CREDO	0.636	0.139	0.611	0.002
Rv1084.2	1	1ya3_STR_B_2001 PDB CREDO	0.785	0.031	0.606	0.002
Rv1084.1	2	3a2q_ACA_A_601 PDB CREDO	0.601	0.178	0.601	0.002
Rv1084.2	1	1jip_KTN_A_801 PDB CREDO	0.651	0.124	0.600	0.002
Rv1084.2	1	2w8y_NDR_B_1000 PDB CREDO	0.595	0.186	0.595	0.002
Rv1084.2	1	1ya3_STR_A_1001 PDB CREDO	0.765	0.040	0.590	0.003
Rv1084.2	1	1jg3_ADN_B_550 PDB CREDO	0.612	0.165	0.588	0.003
Rv1084.2	1	1ict_T44_C_128 PDB CREDO	0.637	0.138	0.587	0.003
Rv1084.1	2	3ijx_HCZ_D_800 PDB CREDO	0.660	0.115	0.587	0.003
Rv1084.2	1	2o7o_DXT_A_222 PDB CREDO	0.610	0.167	0.586	0.003
Rv1084.2	1	3bbt_FMM_B_91 PDB CREDO	0.630	0.145	0.583	0.003
Rv1084.2	1	2xpw_OTC_A_222 PDB CREDO	0.605	0.173	0.581	0.003
Rv1084.2	1	1jin_KTN_A_801 PDB CREDO	0.579	0.205	0.579	0.003
Rv1084.2	1	2trt_TAC_A_222 PDB CREDO	0.602	0.176	0.579	0.003
Rv1084.2	1	3h52_486_C_4 PDB CREDO	0.698	0.082	0.578	0.003
Rv1084.2	1	2vke_TAC_A_222 PDB CREDO	0.599	0.180	0.576	0.003
Rv1084.2	1	2aa5_STR_A_301 PDB CREDO	0.826	0.016	0.575	0.003
Rv1084.2	1	1p93_DEX_A_1999 PDB CREDO	0.769	0.038	0.573	0.003
Rv1084.2	1	1jg3_ADN_A_500 PDB CREDO	0.666	0.109	0.572	0.003
Rv1084.2	1	2aa5_STR_B_302 PDB CREDO	0.819	0.018	0.570	0.004
Rv1084.2	1	1p93_DEX_B_2999 PDB CREDO	0.765	0.040	0.570	0.004
Rv1084.2	1	2xpv_MIY_A_1209 PDB CREDO	0.714	0.071	0.570	0.004
Rv1084.2	1	2aax_PDN_A_502 PDB CREDO	0.812	0.021	0.566	0.004
Rv1084.2	1	2aax_PDN_B_503 PDB CREDO	0.812	0.021	0.566	0.004
Rv1084.2	1	3ls4_TCI_H_220 PDB CREDO	0.565	0.223	0.565	0.004
Rv1084.2	1	2ity_IRE_A_2020 PDB CREDO	0.565	0.224	0.565	0.004
Rv1084.2	1	2w9s_TOP_D_1158 PDB CREDO	0.637	0.137	0.564	0.004
Rv1084.2	1	2q1v_PDN_A_248 PDB CREDO	0.729	0.060	0.563	0.004
Rv1084.2	1	2h42_VIA_B_902 PDB CREDO	0.679	0.098	0.562	0.004
Rv1084.2	1	2h42_VIA_C_903 PDB CREDO	0.679	0.098	0.562	0.004
Rv1084.2	1	2h42_VIA_A_901 PDB CREDO	0.754	0.046	0.562	0.004
Rv1084.2	1	2aa6_STR_A_401 PDB CREDO	0.805	0.023	0.561	0.004
Rv1084.2	1	2xn5_FUN_A_1356 PDB CREDO	0.584	0.199	0.561	0.004
Rv1084.2	1	3ads_IMN_B_3 PDB CREDO	0.660	0.114	0.560	0.004
Rv1084.2	1	1ie4_T44_B_328 PDB CREDO	0.582	0.201	0.560	0.004
Rv1084.2	1	2aa6_STR_B_402 PDB CREDO	0.802	0.024	0.559	0.004
Rv1084.2	1	2ito_IRE_A_2020 PDB CREDO	0.603	0.175	0.558	0.004
Rv1084.2	1	2itz_IRE_A_2021 PDB CREDO	0.580	0.203	0.558	0.004
Rv1084.2	1	2uxo_TAC_B_1211 PDB CREDO	0.580	0.203	0.558	0.004
Rv1084.2	1	1ya4_CTX_C_3 PDB CREDO	0.555	0.237	0.555	0.005
Rv1084.2	1	3jwq_VIA_B_901 PDB CREDO	0.671	0.105	0.555	0.005
Rv1084.2	1	1ya4_CTX_B_2 PDB CREDO	0.552	0.241	0.552	0.005
Rv1084.4	2	3el4_ROC_A_100 PDB CREDO	0.647	0.128	0.552	0.005
Rv1084.2	1	1a28_STR_A_1 PDB CREDO	0.689	0.089	0.551	0.005
Rv1084.2	1	3q1e_T44_C_128 PDB CREDO	0.594	0.187	0.549	0.005
Rv1084.2	1	3bbt_FMM_D_91 PDB CREDO	0.735	0.057	0.548	0.005
Rv1084.2	1	1mx1_THA_F_6 PDB CREDO	0.547	0.249	0.547	0.005
Rv1084.2	1	1mx1_THA_D_4 PDB CREDO	0.545	0.251	0.545	0.005
Rv1084.2	1	2ab2_SNL_B_503 PDB CREDO	0.860	0.008	0.544	0.006
Rv1084.2	1	1jg2_ADN_A_500 PDB CREDO	0.705	0.077	0.544	0.006
Rv1084.2	1	2ab2_SNL_A_502 PDB CREDO	0.860	0.009	0.544	0.006
Rv1084.1	1	1lhu_EST_A_301 PDB CREDO	0.578	0.206	0.538	0.006
Rv1084.1	2	3o0q_ADN_B_1004 PDB CREDO	0.638	0.136	0.538	0.006
Rv1084.1	1	3hku_TOR_A_300 PDB CREDO	0.537	0.262	0.537	0.006
Rv1084.4	2	1t7i_017_A_200 PDB CREDO	0.629	0.146	0.537	0.006
Rv1084.2	1	2oax_SNL_C_3001 PDB CREDO	0.849	0.011	0.537	0.006
Rv1084.4	2	1k6c_MK1_B_902 PDB CREDO	0.628	0.147	0.536	0.006
Rv1084.1	2	3re0_CPT_B_201 PDB CREDO	0.690	0.089	0.535	0.006
Rv1084.2	1	3aod_RFP_C_2002 PDB CREDO	0.623	0.153	0.535	0.006
Rv1084.2	1	3vhu_SNL_A_1001 PDB CREDO	0.845	0.012	0.534	0.006
Rv1084.2	1	3gn8_DEX_B_247 PDB CREDO	0.792	0.028	0.534	0.006
Rv1084.2	1	3jwq_VIA_D_901 PDB CREDO	0.715	0.070	0.532	0.007
Rv1084.2	1	3gn8_DEX_A_247 PDB CREDO	0.788	0.029	0.531	0.007
Rv1084.1	1	1ya3_STR_C_3001 PDB CREDO	0.531	0.271	0.531	0.007
Rv1084.2	1	1p93_DEX_C_3999 PDB CREDO	0.787	0.030	0.530	0.007
Rv1084.2	1	3mne_DEX_A_784 PDB CREDO	0.787	0.030	0.530	0.007
Rv1084.1	2	1lik_ADN_A_799 PDB CREDO	0.561	0.228	0.529	0.007
Rv1084.1	1	1fr6_AZR_B_362 PDB CREDO	0.569	0.218	0.528	0.007
Rv1084.2	1	1p93_DEX_D_4999 PDB CREDO	0.782	0.032	0.527	0.007
Rv1084.1	1	2xpv_MIY_A_1209 PDB CREDO	0.566	0.222	0.527	0.007
Rv1084.1	3	2cbr_A80_A_201 PDB CREDO	0.547	0.248	0.527	0.007
Rv1084.2	1	1m2z_DEX_D_401 PDB CREDO	0.781	0.032	0.527	0.007
Rv1084.2	1	1nhz_486_A_800 PDB CREDO	0.731	0.059	0.527	0.007
Rv1084.2	2	3g0e_B49_A_9000 PDB CREDO	0.548	0.246	0.527	0.007
Rv1084.2	1	2oax_SNL_B_2001 PDB CREDO	0.832	0.015	0.526	0.007
Rv1084.2	1	1ie4_T44_A_128 PDB CREDO	0.571	0.216	0.526	0.007
Rv1084.2	1	1mrl_DOL_A_300 PDB CREDO	0.595	0.185	0.526	0.007
Rv1084.1	1	3jwq_VIA_B_901 PDB CREDO	0.545	0.250	0.526	0.007
Rv1084.2	1	1mx1_THA_C_3 PDB CREDO	0.658	0.117	0.526	0.007
Rv1084.1	2	3o0q_ADN_A_1004 PDB CREDO	0.624	0.152	0.526	0.007
Rv1084.2	1	3kw2_ADN_B_300 PDB CREDO	0.525	0.279	0.525	0.007
Rv1084.2	1	3q1e_T44_D_328 PDB CREDO	0.620	0.156	0.525	0.007
Rv1084.2	1	3f4x_KLT_A_300 PDB CREDO	0.568	0.220	0.525	0.007
Rv1084.1	1	2h42_VIA_C_903 PDB CREDO	0.545	0.251	0.525	0.007
Rv1084.4	2	1c6z_ROC_B_505 PDB CREDO	0.678	0.099	0.525	0.007
Rv1084.2	1	1m2z_DEX_A_301 PDB CREDO	0.777	0.034	0.524	0.008
Rv1084.2	1	2xn6_T44_A_1370 PDB CREDO	0.545	0.251	0.524	0.008
Rv1084.2	1	1uho_VDN_A_1000 PDB CREDO	0.591	0.190	0.523	0.008
Rv1084.1	1	2h42_VIA_B_902 PDB CREDO	0.542	0.255	0.523	0.008
Rv1084.2	1	1mx1_THA_A_1 PDB CREDO	0.590	0.191	0.522	0.008
Rv1084.2	1	1udu_CIA_B_2003 PDB CREDO	0.616	0.160	0.522	0.008
Rv1084.1	1	3g0e_B49_A_9000 PDB CREDO	0.633	0.142	0.522	0.008
Rv1084.2	1	1a27_EST_A_350 PDB CREDO	0.543	0.254	0.522	0.008
Rv1084.2	2	3fuu_ADN_A_0 PDB CREDO	0.588	0.194	0.521	0.008
Rv1084.2	1	3cs8_BRL_A_503 PDB CREDO	0.521	0.286	0.521	0.008
Rv1084.4	2	1c6y_MK1_B_524 PDB CREDO	0.785	0.031	0.520	0.008
Rv1084.1	1	4e3a_ADN_B_500 PDB CREDO	0.539	0.259	0.520	0.008
Rv1084.2	1	2xn7_T44_A_1355 PDB CREDO	0.540	0.258	0.519	0.008
Rv1084.1	1	3k2h_LYA_B_514 PDB CREDO	0.558	0.233	0.519	0.008
Rv1084.1	1	3kw2_ADN_A_300 PDB CREDO	0.538	0.261	0.519	0.008
Rv1084.2	2	1v8b_ADN_C_2502 PDB CREDO	0.562	0.227	0.518	0.008
Rv1084.2	1	1sqn_NDR_A_1001 PDB CREDO	0.649	0.126	0.518	0.008
Rv1084.2	1	1sqn_NDR_B_2001 PDB CREDO	0.647	0.127	0.517	0.008
Rv1084.1	1	1oq5_CEL_A_701 PDB CREDO	0.536	0.264	0.517	0.008
Rv1084.2	1	1m17_AQ4_A_999 PDB CREDO	0.560	0.230	0.517	0.008
Rv1084.1	1	1fr6_AZR_A_362 PDB CREDO	0.557	0.235	0.516	0.008
Rv1084.1	1	2aa5_STR_A_301 PDB CREDO	0.636	0.138	0.516	0.009
Rv1084.1	3	3fuu_ADN_A_0 PDB CREDO	0.536	0.264	0.516	0.009
Rv1084.1	1	1ya3_STR_B_2001 PDB CREDO	0.574	0.212	0.515	0.009
Rv1084.2	2	1v8b_ADN_D_3502 PDB CREDO	0.537	0.262	0.515	0.009
Rv1084.1	1	2aa5_STR_B_302 PDB CREDO	0.635	0.140	0.515	0.009
Rv1084.4	2	1rl8_RIT_A_9001 PDB CREDO	0.650	0.125	0.515	0.009
Rv1084.4	2	3oxc_ROC_A_401 PDB CREDO	0.527	0.278	0.515	0.009
Rv1084.2	1	2ij7_TPF_F_2474 PDB CREDO	0.726	0.062	0.515	0.009
Rv1084.1	1	3aod_RFP_C_2002 PDB CREDO	0.514	0.296	0.514	0.009
Rv1084.2	2	1v8b_ADN_B_1502 PDB CREDO	0.536	0.263	0.514	0.009
Rv1084.4	2	2nnp_ROC_A_401 PDB CREDO	0.602	0.177	0.513	0.009
Rv1084.1	2	2wd9_IBP_A_1570 PDB CREDO	0.581	0.203	0.513	0.009
Rv1084.2	1	2xrl_DXT_A_1211 PDB CREDO	0.605	0.173	0.513	0.009
Rv1084.2	1	3k54_1N1_A_1 PDB CREDO	0.596	0.184	0.512	0.009
Rv1084.2	1	3e22_LOC_D_700 PDB CREDO	0.809	0.022	0.511	0.009
Rv1084.2	2	3ubo_ADN_A_353 PDB CREDO	0.556	0.236	0.511	0.009
Rv1084.2	1	3e22_LOC_B_700 PDB CREDO	0.808	0.022	0.511	0.009
Rv1084.1	2	3ijx_HCZ_B_800 PDB CREDO	0.709	0.074	0.510	0.009
Rv1084.2	1	2ayl_FLP_B_2701 PDB CREDO	0.553	0.240	0.510	0.009
Rv1084.1	3	2kce_D16_A_566 PDB CREDO	0.509	0.305	0.509	0.010
Rv1084.1	1	3bl1_BL1_A_300 PDB CREDO	0.548	0.247	0.508	0.010
Rv1084.1	1	3sv9_SV6_A_1 PDB CREDO	0.548	0.247	0.508	0.010
Rv1084.1	2	3h9u_ADN_A_439 PDB CREDO	0.540	0.258	0.508	0.010
Rv1084.1	2	3ozk_T44_A_128 PDB CREDO	0.570	0.216	0.508	0.010
Rv1084.1	3	3k2h_LYA_A_514 PDB CREDO	0.527	0.277	0.507	0.010
Rv1084.2	1	3mnp_DEX_A_784 PDB CREDO	0.827	0.016	0.507	0.010
Rv1084.1	1	2pou_I7A_A_1000 PDB CREDO	0.546	0.249	0.507	0.010
Rv1084.1	1	4eyb_0WO_B_301 PDB CREDO	0.507	0.307	0.507	0.010
Rv1084.4	2	2qak_1UN_A_1001 PDB CREDO	0.655	0.120	0.507	0.010
Rv1084.2	2	3ubo_ADN_B_353 PDB CREDO	0.551	0.242	0.507	0.010
Rv1084.2	1	3mno_DEX_A_784 PDB CREDO	0.827	0.016	0.507	0.010
Rv1084.1	1	3h52_486_C_4 PDB CREDO	0.525	0.280	0.506	0.010
Rv1084.1	2	2x0p_ADN_A_1607 PDB CREDO	0.569	0.219	0.506	0.010
Rv1084.4	2	2q64_1UN_B_1001 PDB CREDO	0.654	0.121	0.506	0.010
Rv1084.2	1	3d90_NOG_A_1001 PDB CREDO	0.702	0.079	0.506	0.010
Rv1084.4	2	2pym_1UN_A_1001 PDB CREDO	0.653	0.121	0.505	0.010
Rv1084.1	3	3nrr_D16_B_530 PDB CREDO	0.568	0.219	0.505	0.010
Rv1084.2	1	1lhu_EST_A_301 PDB CREDO	0.632	0.143	0.505	0.010
Rv1084.1	1	1p93_DEX_A_1999 PDB CREDO	0.582	0.201	0.505	0.010
Rv1084.4	2	3prs_RIT_A_1001 PDB CREDO	0.636	0.138	0.505	0.010
Rv1084.1	1	1i2w_CFX_B_2300 PDB CREDO	0.611	0.166	0.504	0.010
Rv1084.1	1	1zgf_TRU_A_300 PDB CREDO	0.544	0.253	0.504	0.010
Rv1084.1	3	3ti1_B49_A_299 PDB CREDO	0.524	0.281	0.504	0.010
Rv1084.2	1	3r9c_ECL_A_451 PDB CREDO	0.868	0.007	0.504	0.010
Rv1084.4	2	2q63_1UN_A_1001 PDB CREDO	0.651	0.123	0.504	0.010
Rv1084.4	2	2pyn_1UN_A_1001 PDB CREDO	0.650	0.124	0.503	0.010
Rv1084.1	2	3ilu_HFZ_E_800 PDB CREDO	0.565	0.223	0.503	0.010
Rv1084.1	1	1i2w_CFX_A_1300 PDB CREDO	0.610	0.167	0.503	0.010
Rv1084.1	1	3k54_1N1_A_1 PDB CREDO	0.503	0.314	0.503	0.010
Rv1084.2	1	3d90_NOG_B_2001 PDB CREDO	0.697	0.083	0.502	0.011
Rv1084.1	1	1ya3_STR_A_1001 PDB CREDO	0.559	0.232	0.502	0.011
Rv1084.1	1	1p93_DEX_B_2999 PDB CREDO	0.578	0.206	0.502	0.011
Rv1084.2	1	1lhv_NOG_A_301 PDB CREDO	0.768	0.038	0.501	0.011
Rv1084.1	3	3kw2_ADN_A_300 PDB CREDO	0.520	0.287	0.501	0.011
Rv1084.2	1	1z9h_IMN_A_379 PDB CREDO	0.590	0.191	0.500	0.011

Similarity to known drug target from sensitive sequence analysis

No drug targets

List of small molecules tested from TIBLE

Data not available

Off-target activity - ligand based from TIBLE

Data not available

Small molecules involved in protein-protein complex from TIMBAL .Proteins similar to Mtb based on sequence analysis.

Data not available

STITCH interactions

No high confidence interactions