Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF15145.1\|D2H0S3_AILME/1-127	54-94	1.83e-03	Gated mechanosensitive channel	0.015	Gated mechanosensitive channel	2oar A:10-118	SGNGSHSLFFMGLIIVLIVSLALVSFVIFLIVQTGNKMDDM
PF15145.1\|D2H0S3_AILME/1-127	93-118	4.16e-01	Leucine zipper domain	0.0070	Leucine zipper domain	1a93 B:	DMSRRLTAEGKDIDDLKKINSMIVKR