Content-Type: text/html; charset=ISO-8859-1
SUPERFAMILY Assignment Results
SUPERFAMILY Assignment Results
For full description of the columns visit the SUPERFAMILY website
Seq_ID | Match_region | Superfamily E_value | SCOP superfamily | Family E_value | SCOP family | Closest structure | Alignment |
---|
PF13901.1|A9UU05_MONBE/125-328 | 153-199 | 2.06e-03 | FYVE/PHD zinc finger | 0.013 | PHD domain | 1wev A: | LGDHCELCGNSRQlfAFDDDVIRCEGCNTLYHQQCYTGPAA--------- ---CRRCQR
|
---|
PF13901.1|A9UU05_MONBE/125-328 | 50-121 | 2.75e-03 | RecG, N-terminal domain | 0.0088 | RecG, N-terminal domain | 1gm5 A:7-105 | DKPLLNLRELNASLFGHVESLFRARHLRRRLYRMASYVVSCSHAQEERLL RSLRERPHFVARSQMWSLVDLI
|