Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF13863.1\|D2V5V3_NAEGR/41-170	26-56	4.31e-01	Leucine zipper domain	0.0063	Leucine zipper domain	2o7h A:1-32	RMDAIKKKEKGLLGKKQELTENVKELDKFIG
PF13863.1\|D2V5V3_NAEGR/41-170	72-124	1.33e-01	Type III secretion system domain	0.039	TyeA-like	1xl3 C:2-92	EQGERIKSEGKITDAKNDIDKLEKEKQFKESLLINHYIKYQQFLQKVVQF RGD