Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF11168.3\|A8FUL1_SHESH/16-155	15-95	5.89e-01	Cytochrome c oxidase subunit I-like	0.018	Cytochrome c oxidase subunit I-like	1fft A:	LCKFFNWNYGVYFTVTPILLLGMIPkMTGHAArQCLASALVCGLEVGIFG GFFGGHPVLMSIIVFLLFLYKFACMSKGSLF