Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF10754.4\|A7MG59_CROS8/23-164	15-124	1.57e-01	Cation efflux protein transmembrane domain-like	0.017	Cation efflux protein transmembrane domain-like	2qfi A:5-208	AAGLIFSLIFLPVEFFDLISAISAYFSRSgIITWYAAGAVVLLVALIGIT AYASWHFFQRKRHTPRAMVIYYLAGVVSALWFAVLPVSLFGASWDNSSIR SVLSAFIGVT