Content-Type: text/html; charset=ISO-8859-1
SUPERFAMILY Assignment Results
SUPERFAMILY Assignment Results
For full description of the columns visit the SUPERFAMILY website
| Seq_ID | Match_region | Superfamily E_value | SCOP superfamily | Family E_value | SCOP family | Closest structure | Alignment |
|---|
| PF10154.4|Q68F89_XENTR/37-545 | 367-434 | 2.44e-03 | Macro domain-like | 0.018 | Macro domain | 1hjz A: | NQSNLLPGEFYVTRHSNL--SEMHVVFHLCVDDSVRSGNITARDPAIMGL
RNILKVCCTHDITTINIPLL
|
|---|
| PF10154.4|Q68F89_XENTR/37-545 | 131-196 | 2.56e-02 | Ribosome recycling factor, RRF | 0.017 | Ribosome recycling factor, RRF | 1dd5 A: | RERQGTEMNKVMQELGKSLTDQDVNSVAAQHFESQQVLENKWSTELQQLS
TIQKQEYQEWVIKLHH
|
|---|