Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF10028.4\|Q3A012_PELCD/21-206	8-59	1.54e-01	Multidrug efflux transporter AcrB transmembrane domain	0.027	Multidrug efflux transporter AcrB transmembrane domain	1iwg A:7-37,A:331-498	SARALAWRERLDRTTNWAVAATAAFLGFAFSHPEITHAAFLFGLAMVYIL LF