Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF08006.6\|Q2B3F4_9BACI/1-181	87-157	1.01e-01	Multidrug efflux transporter AcrB transmembrane domain	0.0097	Multidrug efflux transporter AcrB transmembrane domain	1iwg A:513-566,A:869-1036	SLSFFNLVFILGPLIGLAGVYISLCAVALVLTLSPFALLGSSFFTGFEDM TLNFFASlalfsLGLLLSIGM