Content-Type: text/html; charset=ISO-8859-1
SUPERFAMILY Assignment Results
SUPERFAMILY Assignment Results
For full description of the columns visit the SUPERFAMILY website
| Seq_ID | Match_region | Superfamily E_value | SCOP superfamily | Family E_value | SCOP family | Closest structure | Alignment |
|---|
| PF07600.6|Q8F4V2_LEPIN/1-171 | 83-118 | 1.47e-01 | Ribbon-helix-helix | 0.065 | CopG-like | 2cpg A: | MKRISVRVPSASWTLLGTLAQAHGVSKCYLFNYLLK
|
|---|
| PF07600.6|Q8F4V2_LEPIN/1-171 | 113-157 | 2.21e-01 | L domain-like | 0.071 | Leucine rich effector protein YopM | 1jl5 A: | FNYLLKLEALGVGNSILNTvragVPTFHWSYSYILHLDLSNNQV------
-----------------------------------------T
|
|---|