Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF07289.6\|Q17LJ5_AEDAE/5-340	19-75	3.44e-03	PH domain-like	0.046	VPS36 N-terminal domain-like	2cay A:1-99,A:252-282	IRSGEQPLEILDSIEDTKGNL---GDRGRLLVTNLRIIWYSVTSNRFSLS IGFSCVLTMN
PF07289.6\|Q17LJ5_AEDAE/5-340	173-217	3.20e-02	PH domain-like	0.090	TFIIH domain	1pfj A:	GIFILTNVRLVWFAEMNNS-FNISLPYMQISNIRIRESKYGPAL-VI