Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF07077.6\|A3ZA66_9SYNE/50-235	37-101	4.97e-02	Cation efflux protein transmembrane domain-like	0.015	Cation efflux protein transmembrane domain-like	2qfi A:5-208	ETRALFGHERARRQRLIARTVVFTFMSIGLLSLSIQDMHHAKGALPEWLR ILVYFAAMFATWMQL