Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF06643.6\|Q8ZR42_SALTY/1-82	16-72	6.28e-01	Cytochrome c oxidase subunit III-like	0.016	Cytochrome c oxidase subunit III-like	1ocr C:	LMALLSSLLLPAPSLG--LALAQKLVGIFHLMDLNQLYTLLFCLWFLLLG ALEYYV---IRF