Content-Type: text/html; charset=ISO-8859-1 SUPERFAMILY Assignment Results

SUPERFAMILY Assignment Results

For full description of the columns visit the SUPERFAMILY website

Seq_ID	Match_region	Superfamily E_value	SCOP superfamily	Family E_value	SCOP family	Closest structure	Alignment
PF06030.7\|Q74P49_BACC1/41-162	4-63	1.41e-01	Phage fibre proteins	0.064	Lactophage receptor-binding protein domain	2f0c A:17-62	SIHVPDNQLGDIKNYFNLQVKKKQNQTVKMDVHNKANTPIKVNVKVANAL TSTNGGIMYV
PF06030.7\|Q74P49_BACC1/41-162	74-107	2.67e-01	NEAT domain-like	0.014	NEAT domain	2ite A:64-184	TDTDFYMDQYVQAPDAVNLEGNQTKtIEVHLTTP